KEGG   Klebsiella sp. LTGPAF-6F: BJF97_18325Help
Entry
BJF97_18325       CDS       T05751                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00500  Starch and sucrose metabolism
kll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BJF97_18325
Enzymes [BR:kll01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BJF97_18325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C Malt_amylase_C UPF0016 DUF1939
Motif
Other DBs
NCBI-ProteinID: AOV12883
UniProt: A0A1D8JW19
LinkDB All DBs
Position
3922920..3924407
Genome map
AA seq 495 aa AA seqDB search
MKKPTLLQCFHWYYPTGGELWREVEALAPNLNEIGINMIWLPPAYKGASGGYSVGYDCYD
LFDLGEFDQKGSVATKYGDKTQLLAAISALRQHDIAVLLDVVVNHKMGADEKEPVRIQRV
DQNDRTQIAEEIVECEAWTRYTFPVRAGKYSEFIWDYKCFSGIDHIENPDEDGVFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNRAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKEWIDHVQEVATKPLFIVAEYWSHEVDKLQQYIDMVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYADLFGASYEDTGGDGETYAVEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCI
AFSRSGTEEDPGCVVVLSNGDDGEKTLPLGENYRNKRWRDFLGNREEVIETDDEGNGVFT
CNGGSVSVWVIEEAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacccacgttactgcagtgctttcactggtactaccccaccggcggcgaatta
tggcgtgaagtcgaagccctggcgccaaacctcaacgaaatcggcattaacatgatttgg
ttgcctcctgcctacaaaggcgcctccggcggctactctgtcggttatgattgctacgat
ctgtttgacctcggcgaattcgaccagaaggggtctgtcgccacgaaatatggcgataaa
acccagctactggccgccatatccgccctgcgccagcacgatatcgccgtactccttgac
gtcgtggtcaaccataaaatgggcgcggatgaaaaagagccggtacgtattcagcgtgtt
gatcaaaacgaccgcacgcaaatcgccgaggagattgtggaatgtgaagcctggacgcgc
tacaccttcccggtacgcgccggcaaatactctgaattcatctgggattataagtgcttt
agcggcatcgaccatattgagaatcctgatgaagatggcgtgtttaaaatcgtcaacgac
tataccggcgaaggatggaacgatcaggttgatgatgaaatgggtaacttcgactacctg
atgggtgaaaatatcgattttcgcaatcgagcggtgacagaggagattaagtactgggcc
cgctgggtgatggaacaaaccggctgcgatggcttccgcctcgatgcggttaaacatatc
cccgcctggttttataaagagtggatcgaccacgtccaggaggtggcgacaaagccgctg
tttattgtggcggaatactggtcgcatgaagtcgataagctccagcagtatatcgacatg
gttgacggtaagacgatgctctttgacgcgccgctgcagatgaaattccatgaagcctcg
cggcagggacgcgactatgacatgagccagatttttagcggtacgctggtggaagccgac
ccgttccacgccgtaaccctggtgaccaaccatgatacccagccgctgcaggcgctggag
gcgccggttgaggcctggttcaaaccgctggcttatgcactcattttgttacgtgaaaac
ggcgttccgtccgtcttttatgccgacctgttcggcgccagctacgaagataccggcggc
gacggcgagacctacgccgttgagatgccggttattgagcaattacacgaactgatcgat
gcccgtcagcgttttgctcacggcgtacaaactttgtggttcgatcatccgaactgtatc
gctttcagccgcagcggtaccgaagaggatccgggctgcgtggtggtgctttccaacggt
gacgacggagaaaaaacgcttcctctgggggaaaactaccgtaataaacgctggcgtgat
tttctcggcaaccgcgaggaagtgattgaaaccgacgatgaaggaaacggggtttttacc
tgtaacggcggcagcgtcagcgtctgggttatcgaagaggcgctataa

DBGET integrated database retrieval system