KEGG   Klebsiella sp. LTGPAF-6F: BJF97_25710
Entry
BJF97_25710       CDS       T05751                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00052  Galactose metabolism
kll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BJF97_25710
Enzymes [BR:kll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     BJF97_25710
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Methyltransf_25 MTS PrmA UDPG_MGDP_dh_N Methyltransf_31 CoA_binding Methyltransf_11 ELFV_dehydrog Shikimate_DH 3HCDH_N Pyr_redox_2 PALP
Other DBs
NCBI-ProteinID: AOV14247
UniProt: A0A1D8JZU8
LinkDB
Position
5498624..5499667
AA seq 347 aa
MQSVVIHAEGTVRVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGSAVTDLQPGDAVACVPLLPCFNCPQCQREYFSLCKQYQFVGSRSEGGNAQY
VVVKRANLFRLPDQMPIDDGAFIEPMTVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGAKSITAIDINPQKLALAKMLGATHVFNSKEMSGKQIQTALEEIQFDQLVLETAGTP
QTVALGIEVAGPRAQLALVGTLHHDLTLPFATFGQILRKELTIVGSWMNYSGPWPGKEWQ
TAVRLLTEKRIQLAPLITHIGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcaatcagtggttatccatgctgaggggacagtgcgcgttgaagaacgcccgataccg
actctacaaacggaaaacgatgtcctggtcaaagtcgtcagctccggattgtgcggttcc
gatattccgcgcatcttcgccaaaggcgcccactactatcccatcaccctgggtcatgag
ttcagcggctatgttgaatcttatggctcagcggtgaccgacctgcagccgggcgacgcg
gtagcctgcgtgcctctgctcccctgttttaactgcccccagtgccagcgcgaatacttc
tctctctgcaaacagtaccagtttgtcggttcgcgcagcgaaggcggaaatgcgcagtac
gtggtggtcaaacgcgccaacctgttccgtctgccggaccagatgccgattgatgacggc
gcgtttattgaaccgatgaccgtcggcctgcacgccttccatctggctcagggctgcgaa
gggaaaaacgtcattattattggcgcaggcacaattggtttgctggcgttgcagtgcgcc
cgcgaactgggcgccaaaagcattacggcaatcgatatcaacccgcagaagctggcgctg
gcaaaaatgctcggcgcaacgcacgtctttaacagcaaggagatgagcggcaaacagatt
caaacggcgctggaagagattcagttcgaccagctggtgctggaaaccgccggtacgccg
caaaccgtggcgctgggcattgaggtcgccggaccgcgcgcgcagctggcgctggtgggt
accttgcaccatgacttaacgctgcctttcgccacctttggccagattcttcgaaaagag
ctgactattgtcggcagctggatgaactactcgggcccgtggcctggaaaagagtggcaa
acggcggttcgcctgctgacggaaaaacgcattcagcttgccccgcttatcacccacatc
ggcgatgccgaaagctttgcccgcgaagtccaggcgctcaacggtgcgccgatgcagggg
aaaatcctgcttaaactctcctga

DBGET integrated database retrieval system