KEGG   Klebsiella sp. LTGPAF-6F: BJF97_26285Help
Entry
BJF97_26285       CDS       T05751                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00061  Fatty acid biosynthesis
kll00620  Pyruvate metabolism
kll00640  Propanoate metabolism
kll01100  Metabolic pathways
kll01110  Biosynthesis of secondary metabolites
kll01120  Microbial metabolism in diverse environments
kll01130  Biosynthesis of antibiotics
kll01200  Carbon metabolism
kll01212  Fatty acid metabolism
Module
kll_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJF97_26285
   00640 Propanoate metabolism
    BJF97_26285
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BJF97_26285
Enzymes [BR:kll01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BJF97_26285
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BJF97_26285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AOV14351
UniProt: A0A1D8K0C0
LinkDB All DBs
Position
5612549..5613898
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLGEDMDVNRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCSKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVVVKGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QIRIMNDEHFQNGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgttatcgccaaccgcggcgagattgcattgcgtatcctgcgtgcc
tgtaaagaactgggcatcaagaccgttgctgtgcactcaacggcggatcgcgatttaaaa
cacgtattgttagcggatgagacggtctgtatcggcccggctccgtccgtaaaaagctac
ctcaatatcccggcgattatctctgctgccgaaatcaccggcgcggtggctattcacccg
ggttacggatttttgtccgaaaacgcaaacttcgctgagcaggttgagcgttccggcttt
atctttatcggtccgaaagctgacacaatccgcctgatgggcgacaaagtgtctgcgatc
accgcgatgaagaaagcgggcgttccgaccgtaccgggctctgatggcccgctgggcgaa
gatatggacgttaaccgcgcccatgcaaaacgtattggctacccggtgattatcaaagcc
tccggcggcggcggcggtcgcggtatgcgcgttgtgcgcagcgatgctgagctggcgcaa
tccatctccatgaccaaagcggaagccaaagccgcgtttaacaacgacatggtgtatatg
gagaaatacctggagaatcctcgtcacatcgagatccaggtactggctgacggtcagggt
aacgctatctatctggctgagcgcgactgctccatgcagcgtcgtcaccagaaagtggtc
gaagaggcgccagcaccgggcattacgccggaactgcgtcgctatatcggcgagcgttgt
tccaaagcgtgcgtcgatatcggctatcgcggcgcgggtacttttgagttcctgttcgaa
aacggcgagttctatttcatcgaaatgaacacccgtattcaggttgaacacccggtaacc
gaaatgatcaccggcgtcgacctgattaaagagcagctgcgcatcgcagccggccagccg
ctgtccatcaagcaggaagaagttgtggttaaaggccatgcggtggaatgccgtatcaac
gccgaagacccgaacaccttcctgccgagcccgggtaaaattacccgcttccacgcgccg
ggcggttttggcgtgcgctgggagtctcatatctacgcgggctacaccgtgcctccgtac
tatgactcaatgatcggtaagctgatctgctatggcgaaaaccgtgatgtcgcgattgcc
cgcatgaaaaatgcgctgcaggagctgattatcgatggcatcaaaaccaacgttgatctg
cagattcgcatcatgaacgacgaacatttccagaatggtggcaccaatatccactatctg
gagaaaaaactcggattgcaggagaagtaa

DBGET integrated database retrieval system