KEGG   Klebsiella sp. LTGPAF-6F: BJF97_27065Help
Entry
BJF97_27065       CDS       T05751                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00250  Alanine, aspartate and glutamate metabolism
kll00410  beta-Alanine metabolism
kll00640  Propanoate metabolism
kll00650  Butanoate metabolism
kll01100  Metabolic pathways
kll01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJF97_27065
   00650 Butanoate metabolism
    BJF97_27065
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJF97_27065
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJF97_27065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kll01007]
    BJF97_27065
Enzymes [BR:kll01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BJF97_27065
Amino acid related enzymes [BR:kll01007]
 Aminotransferase (transaminase)
  Class III
   BJF97_27065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOV14495
UniProt: A0A1D8K0I9
LinkDB All DBs
Position
complement(5764039..5765304)
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCSYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVTLAERINELAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGITTA
DAMKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPPEFMQALRALCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAERLGSHLKEVLNQARQSCPAIADVRGQGSMVAVEFND
PQTGEPSAEITRQIQQQAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcagcgtcgccagcaggcgactccgcgcggcgtaggggtg
atgtgcagctactttgttgagaaagcggagaacgctacgctgtgggatattgaagggaat
gaggtgatcgatttcgccgccggcatcgcggtgctgaataccggccatcgccaccccaaa
atcgttgccgccgttgaacagcagctgcaggcctttacccacacggcttaccagattgtc
ccgtacgaaagctatgtcacgctggccgagcggattaacgaactggcgccgattgacggt
ccggcaaaaacggcgttctttaccaccggggcggaagccgttgaaaacgcggtgaaaatc
gcgcgcgcttataccggtcgtccggggttgattaccttcggcggcggcttccacggccgt
acgtttatgaccatggcgctgaccggcaaagtggcgccttacaagattggtttcggcccg
ttcccgggctcggtttatcacgccgtctaccctaacgccgcccatggcattaccaccgcc
gatgcgatgaagagcctggagcgcattttcaaagcggatatcgcggccgatcaggtggcg
gcgattgtgctggagccgattcagggggaaggcggctttaacgttgccccgcctgagttt
atgcaggcgctgcgcgcgctgtgcgatacccacggcattctgctgattgccgatgaagta
caaaccggctttgcgcgcaccggcaagctatttgcgatgcagcactatgatgtgaagcct
gacctgatgacgatggccaaaagcctggccggcggtttcccgctctccggcgtggtaggt
cgcgccgaggtgatggatgcgcctgcgccgggcggtctgggcggcacctatgccggtaac
ccgctggcggtcgcggccgcgcatgcggtgctggacgtgatcgaagaagaacagctgtgc
cagcgcgctgagcgcttaggcagccatctgaaagaggtgctgaatcaggcgcgtcaaagc
tgcccggcgattgctgacgtacgaggccaggggtcgatggtggcggtagagtttaacgat
ccgcaaaccggcgagccgtcggcggagatcacccgtcaaatccagcaacaagcccaggag
aacggcctgctgctgctgagctgcggcgtctatggcaacgtcattcgcttcctctatccg
ttaacgattccggatgcgcagtttacgaaagcgctggatattctggcccgcgtgctgaag
ggctag

DBGET integrated database retrieval system