KEGG   Pantoea rwandensis: LH22_03175Help
Entry
LH22_03175        CDS       T03331                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
kln  Pantoea rwandensis
Brite
KEGG Orthology (KO) [BR:kln00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    LH22_03175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB DUF4034
Motif
Other DBs
NCBI-ProteinID: AIR84508
LinkDB All DBs
Position
complement(703185..704186)
Genome map
AA seq 333 aa AA seqDB search
MTDKPNQESTAEKKPLIDINTGNKTVDGSIQNVSRFATWFQAIPAVAHFMRALDRFNDRL
GSQFGAAITYFSFLSLIPILMVSFAAVGFVLASNQDLLTELINKIVNSISDPTLATTLKN
TVNTAIQQRATVGLTGLLLALYSGINWMGNLREAVRAQSRDVWERKPDDQEKLWKKYARD
LVSLLGLMLALVITLSLTSIAGAAQNAIVNALGLEDIEWLRPAMTIIALSISIFANYLLF
LWIFWILPRHKPRKKALFRGTLLAAIGFEVIKFVMTLTLPKLATSPSGAAFGSVLGLMAF
FYFFARLTLFCAAWIATAKYKDDKEMPQPHQGN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaacctaaccaagaatccacggctgaaaagaagccgcttattgatatcaat
accggtaacaaaaccgtggatggctcaatccagaacgtgtcgcggtttgcgacctggttc
caggccattccggcggtggcgcattttatgcgcgcgctggatcggtttaacgatcgcctc
ggcagccagtttggtgcggcgatcacttacttctccttcctatctctgataccgattttg
atggtctcctttgcggcagtcggttttgtgctggcgtcgaatcaggatttactcaccgag
ttgatcaacaaaatcgttaacagcatcagcgatcctacgctggccaccaccctaaagaat
accgtgaacaccgcgattcagcaacgcgcgacggtcgggttaaccggtttgctgctggcg
ctctactctggcatcaactggatgggcaatttgcgcgaggcggtgcgcgcgcagtcgcgc
gatgtgtgggagcggaagccggacgatcaagagaagttgtggaagaaatatgcgcgtgat
ttggtgtcgttgctcggcctgatgctggcattggtgattacgctgtcgctgacctccatt
gccggtgccgcgcagaatgccatcgttaacgcgttgggattggaggatatcgagtggctg
cgcccggcaatgaccatcattgcgctgtcgatctccatttttgccaactatttgttgttc
ctgtggattttctggattctgccgcgccacaagccgcgcaaaaaagcgctgtttcgcggc
acgctgctggcggcgattggctttgaggtgattaagtttgtcatgacgctgacgctgcct
aagctggccacctcaccgtccggcgcagcctttggttcggtgctgggattaatggcgttc
ttttacttcttcgcccgtctgacactgttctgcgccgcgtggatcgccaccgcaaaatac
aaggatgataaagagatgccgcagccgcatcagggcaattaa

DBGET integrated database retrieval system