KEGG   Pantoea rwandensis: LH22_03740Help
Entry
LH22_03740        CDS       T03331                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kln  Pantoea rwandensis
Pathway
kln00564  Glycerophospholipid metabolism
kln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kln00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LH22_03740 (glpD)
Enzymes [BR:kln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LH22_03740 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 3HCDH_N Pyr_redox_2 GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AIR84614
LinkDB All DBs
Position
complement(822752..824260)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAVDAAGRGLSVLMLEARDLACATSSNSSKLIHGGLRYLEHYE
FRLVGEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRLGLFMYDRLGKRTTLPGS
KGLRFGAESALKPEITRGFEYSDCWVDDARMVVLNAQEVVKQGGEVRTRTRVNRAWREGG
LWMVEAEDIDTGKIFTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRVH
CEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKDVKIDDNEISYLLKVFNGHF
KQQLSKDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDNGQAPLLSVFGGKLTTYRK
LAEHAMEKLAKYYPNAGPAWTKSAVLPGGDFSGTREDYAAGLRRRYPFISEGMARHFART
YGSRTEELLAGASSLADLGENFGHEFYEAELRYLVKNEWVRELDDAIWRRTKQGMWLTEA
EQARISEWLAEHGQKPALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtgatcggcggcggcattaacggagccggcattgcagtg
gacgctgcaggacgcggactgtcagtgctgatgctggaggcgcgggatttggcctgtgca
acctcctccaacagctctaaattaatccacggtggcctgcgctacctggaacattacgaa
ttccgcctggtgggcgaagcgctggccgaacgtgaagtgctgctgaaaatggcaccgcac
attgccttcccaatgcgcttccgcttgccacatcgcccgcatctgcgtccggcgtggatg
attcgccttggcctgtttatgtacgaccgcctgggtaaacgcaccaccttaccgggcagt
aaaggcctgcgttttggcgcggaatcggcccttaagcctgagatcacgcgcggattcgaa
tattccgactgctgggtggacgatgctcgcatggtagtacttaacgcgcaggaagttgtg
aaacagggtggcgaagtgcgcacccgcacccgcgttaaccgtgcatggcgcgaaggcggt
ctctggatggtggaagcggaagatatcgataccggcaaaattttcacctggcgcgctaaa
ggcctggtcaacgccgctggcccatgggtgaagcaactgttcgacgatggtctgaaacta
aaatcaccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgcgtacac
tgtgaaaagcaggcttatatcctgcagaacgaagataaccgtatcgtgtttgtgattccg
tggatggacgagttctctatcatcggtacgacggatgtggagtacaaaggcgatccgaaa
gacgtgaagatcgatgacaacgaaattagctatttgctgaaagtgtttaacggacacttc
aaacagcagctgagcaaagatgacatcgtctggacctattctggtgtgcgtccgctgtgt
gatgacgaatcggattctccgcaggccatcacccgtgattacacgctggatgtgcacgat
gacaacggccaggcgccgctgctgtcggtgtttggcggtaagctgaccacctatcgtaag
ctggcagagcacgcaatggagaaactggcgaagtactatcccaacgccggcccagcctgg
actaaatcagcagtactgccaggcggtgatttctctggcacccgtgaagattacgccgcg
ggcttacgtcgtcgctatccgtttatcagcgaaggcatggcgcgccactttgcccgtacc
tacggcagccgcaccgaagaactgctggctggcgcaagcagtctggcggatctgggcgag
aacttcggccacgagttttatgaagctgaattgcgctacctggtgaaaaatgagtgggtg
cgcgaactggatgatgcgatctggcgtcgtaccaaacaaggtatgtggctgacagaagct
gagcaggcgcgcattagtgagtggctggcagaacacggtcagaaaccggcgctgtcgctg
gcatcttaa

DBGET integrated database retrieval system