KEGG   Pantoea rwandensis: LH22_06845
Entry
LH22_06845        CDS       T03331                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
kln  Pantoea rwandensis
Pathway
kln00230  Purine metabolism
kln00240  Pyrimidine metabolism
kln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kln00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LH22_06845
   00240 Pyrimidine metabolism
    LH22_06845
Enzymes [BR:kln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     LH22_06845
    3.2.2.-  
     LH22_06845
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AIR85196
LinkDB
Position
complement(1471249..1472604)
AA seq 451 aa
MITHISPLGSMDLLSQLEVDMLKQTASSDLYQLFRNCSLAVLNSGSQTDSSQELLSRFEN
FDINVLRRERGVKLELINPPEEAFVDGRIIRSLQANLFAVLRDILFVNGQLERSDHKNAD
DSAHITNQVFSILRNARALHIGEYPNTVVCWGGHSINAVEYQYCRNVGTQMGLRELNICT
GCGPGVMEAPMKGAAVGHAQQRYHDSRFIGLTEPSIIAAEPPNPLVNELIIMPDIEKRLE
AFVRIAHGIVIFPGGVGTAEELLYLLGILMNPHNSDQVLPLILTGPKESADYFRVLDDFI
VNTLGETARKHYKIIIDDAAEVARLMKKAMPQVKEYRRETGDAYSFNWSIRIAPELQVPF
VPTHENMANLKLFPNQPAEKLAADLRRAFSGIVAGNVKEVGIREIREKGPYKLHGDADIM
HRMDELLQGFVAQQRMKLPGSAYIPCYEIIK
NT seq 1356 nt   +upstreamnt  +downstreamnt
ttgattacacatatcagcccgcttggctcaatggatctgctctcccagttggaagtcgac
atgctgaagcaaacggccagcagcgacctttaccagctttttcgcaactgctcactcgcg
gtgctcaactccggcagccagaccgacagtagtcaggaactgctctcgcgttttgaaaat
ttcgacatcaacgtgctgcgccgtgagcgcggcgtcaaactcgaactgattaatccgccg
gaagaagcctttgttgatggccgtattatccgctcattgcaggccaacctgtttgccgtg
ctacgcgatattctgtttgtgaatggccaacttgagcgcagcgatcataaaaacgctgac
gattccgctcacatcacgaatcaggtgttttcaattctgcgtaacgcgcgcgcgctgcac
attggtgaatatcccaataccgtggtgtgctggggtggtcactcgattaacgcagtggag
tatcagtattgccgcaatgttggcacacaaatgggcctgcgtgaactcaacatctgcacc
ggctgtgggcctggcgtgatggaagcgccgatgaaaggtgccgcagtgggtcatgcacag
caacgctaccacgacagtcgtttcattggcctgaccgaaccgtcaattatcgcggctgag
ccaccaaatccgctggtgaatgaactgatcatcatgccggatatcgaaaagcgtcttgag
gcgtttgtgcgtattgcgcatggcatcgtgatcttcccgggtggtgtcggcaccgcagaa
gagttgctgtatctgttggggatcctgatgaatccacacaacagcgaccaggtcctgccg
ctgattctcaccggcccgaaagagagcgccgactacttccgggtgctggatgatttcatc
gttaatacgctgggtgaaaccgcgcgtaagcactataagatcatcattgatgatgctgct
gaagtggcacgtctgatgaagaaggccatgccgcaggtcaaagagtatcgtcgcgaaact
ggcgatgcctacagttttaactggtcgattcgcatcgcgccagagttgcaggtaccgttt
gtaccgacgcacgaaaacatggctaacctgaaactgttcccgaaccagccagcggaaaaa
ctggctgcagatttgcgtcgcgctttctctggtattgttgccggcaacgttaaggaggtc
ggcattcgcgaaatccgcgagaaggggccttacaaactgcacggcgacgccgacattatg
catcgcatggatgaactgctgcagggcttcgtcgctcagcagcgtatgaagttgccaggc
agcgcctacatcccctgctacgaaatcattaaataa

DBGET integrated database retrieval system