KEGG   Pantoea rwandensis: LH22_09410Help
Entry
LH22_09410        CDS       T03331                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kln  Pantoea rwandensis
Brite
KEGG Orthology (KO) [BR:kln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH22_09410
Enzymes [BR:kln01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LH22_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 NAD_binding_8 Thi4 Glutaredoxin AlaDh_PNT_C K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AIR85672
LinkDB All DBs
Position
2006898..2008466
Genome map
AA seq 522 aa AA seqDB search
MLDTNLKTQLKAYLEKLTKPVELIATLDDGAKSAEIRSLLTDIASLSEKVSFREENDRPV
RKPSFLITNPGSQSGPRFAGSPMGHEFTSLVLALLQTGGHPSKESQSLLEQVVALDTDLH
FETYYSLSCHNCPDVVQALNLMAVLNPRISHTAIDGGMFQNEITERNVMGVPAVFLNGKE
FGQGRLSLAEIVGKVDTNAEKRAAEELNKREAYEVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVQKTEGAKLAGSLRAHVDDYDVDVIDTQSAIKLIPAAKEG
GLHAIETASGAVLKSRSIIIATGARWRNMGVPGEEQYRTKGVTYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGLVEHVTLLEFASEMRADKVLQDKLRSLKNVDVILNAQTTEVKGD
GSKVTGLSYIDRTNQTSHEIALSGIFVQIGLLPNTTFLEGAVERNKMGEIIIDAKCETSL
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTQPAE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataccaatttaaaaacacagctcaaggcttaccttgagaaattaacgaaaccg
gttgagttgattgccacactggatgatggcgctaaatctgcggagatccgttctctgctg
accgatatcgcgagcttgtcagaaaaagtcagcttccgtgaagagaatgatcgtccggtt
cgtaaaccctctttcctgatcactaacccagggagccagagcggtccccgctttgccggt
tcgccaatgggacacgaatttacttcactggtgctggcactattgcagaccggtggacac
ccttcgaaagagtcgcagagcctgctggagcaagtagtggctctggacaccgacctgcat
ttcgaaacctattactcgctgtcatgccataactgccctgacgtggtacaggcgctgaac
ctgatggcagtgctaaacccacgcatcagccacaccgcgattgatggcggcatgttccag
aacgaaatcactgagcgcaatgtgatgggcgttcctgcggtattcctcaacggcaaagag
ttcggtcagggtcgtttgagcctggcggaaatcgtcggcaaagtggacaccaacgcagag
aagcgtgcggcagaagagctgaacaagcgtgaagcctatgaagtgctgatcgtcggcagc
ggcccagcgggcgcagcggcagcgatttactcggcgcgtaaaggtatccgcacgggcctg
atgggcgagcgttttggtggccaggtactcgacaccgtagacatcgaaaactacatctca
gtccagaaaaccgaaggcgctaagctggcgggttcactgcgcgcccacgttgatgattac
gatgttgacgtcatcgacacccagagcgccatcaagctgattcccgctgccaaagagggc
ggtctgcacgcgattgaaaccgcgtctggcgcagtgctgaaatcacgcagcatcatcatt
gccaccggtgcacgctggcgcaacatgggtgtgccgggtgaagagcagtatcgcaccaaa
ggcgtgacctactgcccacactgcgacggcccgctgttcaaaggtaaacgcacggcggtg
atcggcggcggtaactctggtgttgaagcggctatcgatctggctggcctggttgagcac
gtgacgctgctggaatttgccagcgaaatgcgtgccgacaaagtgctgcaggacaaactg
cgcagcctgaaaaacgtcgatgtgattctgaatgcccagaccaccgaagtgaaaggcgac
ggcagcaaagtgactggcttgagttacatcgatcgtaccaaccagaccagccatgaaatc
gcgctgagcggcatcttcgtgcagattggtctgctgcccaacaccaccttcctcgaaggc
gcggtggaacgtaacaaaatgggcgagatcatcatcgacgccaaatgcgaaaccagcctg
aaaggcgtgttcgcggccggtgactgcaccacggtgccgtacaagcagatcattatcgcc
agcggtgaaggcgcgaaagcctcactcagcgcgtttgattacctgatccgcacccaaccg
gctgaataa

DBGET integrated database retrieval system