KEGG   Pantoea rwandensis: LH22_13700Help
Entry
LH22_13700        CDS       T03331                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kln  Pantoea rwandensis
Pathway
kln00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LH22_13700
Enzymes [BR:kln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LH22_13700
Transporters [BR:kln02000]
 Other Transporters
  Pores ion channels [TC:1]
   LH22_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6 Tom37 RHH_8 GST_N_5 Lar_N
Motif
Other DBs
NCBI-ProteinID: AIR86457
LinkDB All DBs
Position
2926793..2927401
Genome map
AA seq 202 aa AA seqDB search
MMKLYCKPGACSLSPHIVARECGLDFTQVNVDLQKKVTEQGDDYWQINPKGQVPALQFDD
GSLLTEGVAIVQYLADLKPDRNLLAPTGSLTRYHTIEWLSFVSSELHKTFSPLFRPDTPE
EYKAIVRAQLEKKYQVVNEALQDKQWLMGLRYTVADVYLFVVTRWAKAIKLDLSGLAALE
AWFNRVAERPAVQAALKAEGLV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactctattgcaagcccggtgcctgttcgctgtcaccgcatattgttgcgcgt
gaatgcgggttggactttacccaggtcaatgttgacctgcagaaaaaggtcaccgagcag
ggagacgattactggcagattaaccccaaaggacaggttcctgcgctgcaatttgatgac
ggcagtttgttaaccgaaggcgttgctattgtgcagtatctggcggatctgaagccagac
cgcaatctgctggcacccaccggcagcctgacgcgctaccacaccattgaatggctgagc
tttgtcagcagtgaactgcataaaaccttctcaccgctgttccgtccggataccccggaa
gagtacaaagccattgtgcgggcgcagttagagaagaaatatcaggttgtgaatgaagcg
ctgcaagacaagcagtggttgatgggtctgcgttataccgtggccgatgtctatctgttt
gtggttacacgttgggcaaaagccatcaagctggatctgagcgggttagccgcgctggaa
gcctggttcaaccgtgtggcagaacgtccagcggtgcaagcggcgttgaaagcggaaggt
ttggtttaa

DBGET integrated database retrieval system