KEGG   Pantoea rwandensis: LH22_14635
Entry
LH22_14635        CDS       T03331                                 

Definition
(GenBank) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
kln  Pantoea rwandensis
Pathway
kln01503  Cationic antimicrobial peptide (CAMP) resistance
kln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kln00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH22_14635
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LH22_14635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kln01001]
    LH22_14635
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kln02022]
    LH22_14635
   01504 Antimicrobial resistance genes [BR:kln01504]
    LH22_14635
Enzymes [BR:kln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     LH22_14635
Protein kinases [BR:kln01001]
 Histidine kinases
  OmpR family
   LH22_14635
Two-component system [BR:kln02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   LH22_14635
Antimicrobial resistance genes [BR:kln01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    LH22_14635
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HAMP HATPase_c_5 HisKA HATPase_c_2
Other DBs
NCBI-ProteinID: AIR86634
LinkDB
Position
3113944..3115404
AA seq 486 aa
MNWLNRLRPFSLRARFLLATAAIVLFLSLSYGMVAVVGYVVSFDKNTYRVMRGESNLFFT
LAQWQNNKLTIAQPERMTLNFPTLVFIYDEHGKLLWQQRDVPDIRKNIRREWLLKPDFYE
IDTTNRTSLAAIGNNSEVKERLHQLDSDNNDTFTHSVAVNRYDATTNLPALTIVVVDSIP
QELQHSDVVWSWFSYVLAANLLLVIPLLWLAAHWSLRPIGDLTAQVRELETGHRENLDDN
PPQELRSLVRNLNLLLTNERQRYTRYRTTLSDLTHSLKTPLAVLQSTLRSLRSGKELTVE
QAEPVMLEQISRISQQIGYYLHRASMQADHNPLQRDLHSVSALLDSLCSALNKVYQRKGV
EITLDISPELTFVGDQNDFMEVLGNVLDNACKYCLEFIEVSARQTDKALHLFIDDDGPGI
PESKRDLIFVRGQRADTLRPGQGLGLAVVRDILEQYAGQVIASTSPLGGARMEVIFQRQE
VEHHRE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaattggctgaatcgcttacgtcctttctcattacgcgcccggtttttactggcgacc
gccgctattgtgctgtttttgtcgctctcctacggcatggttgccgtagtcggctatgtg
gtgagtttcgataaaaacacttatcgcgtgatgcgcggcgagagcaacctgttcttcacc
ctggcgcagtggcaaaacaataagctgaccattgcccagccagagcgtatgacgctcaat
ttcccgacgctggtgtttatctacgatgaacacggcaagctgctgtggcagcaacgtgat
gtgccggacatccgcaaaaacattcggcgtgagtggctgctcaagcccgatttttatgaa
atcgacaccacaaatcgcaccagtctggccgccatcggcaacaactccgaggtcaaagag
cggttgcatcaactggacagcgacaacaacgacacctttacccactcggtcgccgtcaac
cgttacgatgccaccaccaacttaccggcactgaccatcgtagtggtggattctatcccc
caggaactgcagcactcggatgtggtgtggtcatggtttagctatgtgctggcagcgaac
ctgctgttagtgattccgctgctgtggctggccgcgcactggagcctgcgccctattggt
gatttaaccgcgcaggtgcgggaactggaaacgggtcatcgcgagaacctggacgacaat
ccgccgcaggagttacgcagcctggtgcgaaatctcaacctgctgctgaccaatgagcgc
cagcgctacacgcgttatcgcaccaccctgtctgatttaacgcacagcctgaaaactccg
ctggcggtgttgcagagtaccttgcgctccctgcgcagcggtaaggagctcaccgtggag
caggctgagccggtgatgctggagcagatcagccgtatttcacaacaaattggctactac
ctgcatcgtgccagtatgcaggccgatcataatccgctgcagcgcgatctgcattcggtg
tcggcactattggacagcctttgctcggcgctgaataaggtttatcagcgcaaaggtgtc
gaaatcaccctggatatttcccccgagttgacctttgtcggtgaccaaaatgactttatg
gaagtgctgggcaacgtgctggataacgcctgcaaatactgcctggaatttattgaggtc
agcgcacggcaaaccgacaaggcactgcatctgtttattgatgatgacggccccggcatt
cctgaaagcaaacgcgatctgatcttcgtgcgcggtcagcgtgccgatacgttacgtccc
ggccagggccttggcttagccgtggtccgcgacatcctcgaacaatacgccggtcaggtg
atcgccagcaccagcccgctgggcggtgcccgcatggaagtgattttccagcgtcaggaa
gttgaacatcaccgcgagtag

DBGET integrated database retrieval system