KEGG   Pantoea rwandensis: LH22_16465Help
Entry
LH22_16465        CDS       T03331                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kln  Pantoea rwandensis
Pathway
kln00010  Glycolysis / Gluconeogenesis
kln00260  Glycine, serine and threonine metabolism
kln00680  Methane metabolism
kln01100  Metabolic pathways
kln01110  Biosynthesis of secondary metabolites
kln01120  Microbial metabolism in diverse environments
kln01130  Biosynthesis of antibiotics
kln01200  Carbon metabolism
kln01230  Biosynthesis of amino acids
Module
kln_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kln_M00002  Glycolysis, core module involving three-carbon compounds
kln_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LH22_16465 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    LH22_16465 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LH22_16465 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kln04131]
    LH22_16465 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kln04147]
    LH22_16465 (gpmA)
Enzymes [BR:kln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LH22_16465 (gpmA)
Membrane trafficking [BR:kln04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LH22_16465 (gpmA)
Exosome [BR:kln04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LH22_16465 (gpmA)
  Exosomal proteins of melanoma cells
   LH22_16465 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIR86984
LinkDB All DBs
Position
3505679..3506431
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKTWRLNERHYGALQGLDKAETAAKYGDDQVKQWRRGFA
ITPPELDRADERFPGHDPRYASLTDAQLPTTESLALTIERVIPYWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENFKPLKRYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaactaagctggttctggtgcgacacggcgaaagccagtggaaccaggaaaac
cgcttcaccggatggtatgacgtggatctgtcagacaaaggtcgcaccgaagccaaagca
gccggtcagctgctgaagaaagaaggtttcgtgtttgatttcgcctatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggatgagctggatcaggcgtggctgccg
gttgagaaaacctggcgtctgaatgagcgtcactacggtgcgctgcagggtctggataaa
gccgaaaccgccgccaaatacggcgacgatcaggtgaaacagtggcgtcgtggctttgcc
atcaccccaccagaactggatcgtgcggatgagcgtttcccgggccacgacccacgttac
gcatcactgaccgatgcacagctgccaaccaccgaaagcctggcgctgaccatcgaacgt
gttattccttactggaatgaaagcattctgccgcgcatcaaaagcggtgagaaagttatt
gttgctgcacacggtaactcactgcgtgcactggtaaaatatcttgataacctgagcgaa
gatgaaatcctcgagctgaatatcccaactggcgtgccgttggtgtatgagttcgacgag
aacttcaaaccgctgaagcgttactacctgggtgatgcagacgagattgccgcgaaagcc
gcagccgttgctaaccagggtaaagccaagtaa

DBGET integrated database retrieval system