KEGG   Klebsiella huaxiensis: DA718_03460
Entry
DA718_03460       CDS       T05915                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
klw  Klebsiella huaxiensis
Pathway
klw00052  Galactose metabolism
klw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DA718_03460
Enzymes [BR:klw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     DA718_03460
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_31 TrkA_N 2-Hacid_dh_C Methyltransf_25 MTS PrmA UDPG_MGDP_dh_N 3HCDH_N ELFV_dehydrog Methyltransf_11 Shikimate_DH CoA_binding Peptidase_U32 Pyr_redox_2 Methyltransf_24 Met_10
Other DBs
NCBI-ProteinID: QBG06305
LinkDB
Position
complement(711816..712859)
AA seq 347 aa
MQSVVIHAEGTVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGSAVTDLQPGDAVACVPLLPCFHCPQCQREYFSLCKQYQFVGSRSEGGNAQY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCKGKNVIIIGAGTIGLLALQCA
RELGAKSITAIDINPQKLELAKTLGATRVFNSREMSGKEIQAALEEIQFDQLVLETAGTP
QTVALGIDVAGPRAQLALVGTLHHDLTLPSATFGQILRKELTIVGSWMNYSGPWPGEEWQ
TAVRLLTEKRIQLAPLIAHIGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcaatcagtggtaatccatgctgaggggacagtgtgcgttgaagaacgcccaataccg
actctgcaaacggaaaacgatgtcctggtaaaagttgtcagctccggattgtgcggttct
gatattccgcgcatcttcgccaaaggcgcacactactaccccatcacgctgggccacgag
ttcagcggctatgttgaatcctatggctccgcggtgaccgacctgcagccgggcgatgcg
gtagcctgcgtgcccctgctcccctgctttcactgcccacagtgccagcgtgaatatttc
tcgctgtgcaaacagtatcagttcgtcggttcgcgtagcgaaggcgggaatgcgcaatac
gtcgtcgtcaaacgtgccaacctgttccgcctgccggatcagatgccgattgacgacggg
gcgtttatcgagccaatcaccgttggcctgcacgccttccatctggcacagggatgcaaa
gggaaaaacgtcattattattggcgcaggcaccatcggcctgctggcgctgcagtgcgcc
cgcgaactgggcgccaaaagcattacggcaattgatatcaatccgcagaaactggaactg
gcaaaaacgctcggcgcaacccgcgtcttcaatagcagagagatgagcggtaaagagatt
caggcagcgctggaagagattcagttcgaccagttggtgcttgaaactgcgggtacgcca
caaaccgtggcgctgggcattgacgtcgccgggccgcgcgcgcagctggcgctggtcggc
acgctgcaccatgatttgaccctgccttccgccacctttggtcagattttacgtaaagag
ctgactatcgtcggcagttggatgaactactccggcccgtggcctggggaagagtggcaa
acggcagtgcgcctgctgacggaaaaacgtattcagcttgctccactcatcgcccacatc
ggcgatgcagaaagctttgcccgcgaagtccaggcgctcaacggcgcgccgatgcaggga
aaaatcctgcttaaactctcctga

DBGET integrated database retrieval system