KEGG   Klebsiella sp. WCHKl090001: DA718_09945Help
Entry
DA718_09945       CDS       T05915                                 

Gene name
dacD
Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase DacD
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
klw  Klebsiella sp. WCHKl090001
Pathway
klw00550  Peptidoglycan biosynthesis
klw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DA718_09945 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:klw01002]
    DA718_09945 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:klw01011]
    DA718_09945 (dacD)
Enzymes [BR:klw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DA718_09945 (dacD)
Peptidases [BR:klw01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DA718_09945 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:klw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DA718_09945 (dacD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: QBG07496
LinkDB All DBs
Position
2100738..2101910
Genome map
AA seq 390 aa AA seqDB search
MPLKGRLFIAVTLLAASVSCAFAANDFPVNVTPPSIQAGSWVLMDYTTGQILTAGNEHQQ
RNPASLTKLMTGYVVDRAIDSHRITFDDIVTVGKDAWAQGNPVFNGSSLMFLKPGDRLSV
RDLSRGLIVDSGNDACVALADYVAGGQPQFVALMNSYVEKLHLKDTHFETVHGLDAPGQH
SSAYDLAVLSRAIIHGSPDVYHMYSQKSLTWNGITQQNRNGLLWDKTMNVDGLKTGHTSG
AGFNLIASAVDGQRRLIAVVMGAESPKGREQQAAKLLHWGQQNFDTVQVLQDGKQVGVER
IWYGDKEQIKLGTDQDFWLALPKSEVSRIKAKYVLDKKVLEAPIAAHQRVGEISLYDGDK
VVAHWPLVTLESVGKGGVFSRFSDYLHQKL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgaaaggccgtttgtttattgctgtaactttgctcgctgcgagcgtttcctgc
gcatttgccgccaatgattttcccgtcaacgtgacaccgccttccattcaggccggttcc
tgggtgctgatggattacaccaccggtcagatcctgactgcgggtaacgagcatcagcag
cgcaatcccgcgagtttgaccaaactcatgactggctatgtggttgaccgcgccatcgac
agtcaccgtattaccttcgatgatatcgtcacggtgggtaaagacgcctgggcgcagggt
aacccggtatttaatggttcctcgttgatgttcctgaagcccggcgaccgcctcagcgtg
cgtgatttgagccgcgggctaattgttgactctggtaacgacgcctgcgtggcgttggca
gactatgttgcgggcggtcagccacagtttgtcgcgctgatgaatagctacgtagagaaa
ctgcacttaaaggatacccacttcgaaaccgttcacggtctggacgcgccggggcaacac
agttcggcctacgatttggccgtgctctcgcgggcgattattcatggctcgccggacgtg
tatcatatgtatagtcagaaaagcctgacctggaacggcattacccagcagaaccgtaat
ggcctgctatgggataaaaccatgaacgtcgatggcctgaaaaccggccatacttccggg
gcaggatttaacctgatcgcttcggcggtggatggtcagcgccgtctgattgcggtggtg
atgggggctgaaagcccgaaaggacgggaacaacaggcggcgaagctactgcactggggt
cagcaaaatttcgataccgtacaggttttgcaggacggcaaacaggtcggggttgagcgc
atctggtatggcgataaagagcagattaagctgggcaccgatcaggacttctggctggca
ttgccgaagtcggaagtgtcgcgtattaaagccaaatatgtgttggataaaaaagtgctg
gaagcgccgattgccgcccatcagcgggtcggtgaaatctcgctttatgacggcgataaa
gtggtggcccactggccgctggtgacgctggaaagcgtcggcaagggcggtgttttctcg
cgctttagcgattatttacatcagaagctgtaa

DBGET integrated database retrieval system