KEGG   Klebsiella sp. WCHKl090001: DA718_18335Help
Entry
DA718_18335       CDS       T05915                                 

Gene name
fabA
Definition
(GenBank) bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
klw  Klebsiella sp. WCHKl090001
Pathway
klw00061  Fatty acid biosynthesis
klw01100  Metabolic pathways
klw01212  Fatty acid metabolism
Module
klw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DA718_18335 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:klw01004]
    DA718_18335 (fabA)
Enzymes [BR:klw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DA718_18335 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     DA718_18335 (fabA)
Lipid biosynthesis proteins [BR:klw01004]
 Fatty acid synthase
  Component type
   DA718_18335 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: QBG08998
UniProt: A0A4P6NWV4
LinkDB All DBs
Position
3805688..3806206
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVIKMTETGGNYDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKLTGQVLP
TAKKVTYRIHFKRVINRRLIMGLADGEVLVDDRLIYTATDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagatcttcttgcctctggccgtggtgaa
ctgtttggcgctaaaggcccacagttaccagcgccaaatatgctgatgatggaccgcgtc
atcaagatgaccgaaaccggtggtaactacgataaaggttatgttgaggcagaactcgat
attaaccctgacctgtggttcttcggttgccacttcattggcgatccggttatgcctggc
tgcctgggcctggatgccatgtggcaactggttggcttctacctgggctggttaggcggc
gagggtaaagggcgtgcgttaggcgtaggtgaagttaaactcaccggccaggtactgcca
acggctaagaaagtgacctaccgcattcatttcaaacgcgtgataaaccgtcgtttgatt
atgggcctggcggatggtgaagtactggttgacgatcgtctgatctacaccgcaaccgat
ctgaaagtgggtttattccaggacacctctgcgttctga

DBGET integrated database retrieval system