KEGG   Klebsiella sp. WCHKl090001: DA718_27995Help
Entry
DA718_27995       CDS       T05915                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
klw  Klebsiella sp. WCHKl090001
Pathway
klw00071  Fatty acid degradation
klw00280  Valine, leucine and isoleucine degradation
klw00281  Geraniol degradation
klw00310  Lysine degradation
klw00362  Benzoate degradation
klw00380  Tryptophan metabolism
klw00410  beta-Alanine metabolism
klw00640  Propanoate metabolism
klw00650  Butanoate metabolism
klw00903  Limonene and pinene degradation
klw00930  Caprolactam degradation
klw01100  Metabolic pathways
klw01110  Biosynthesis of secondary metabolites
klw01120  Microbial metabolism in diverse environments
klw01130  Biosynthesis of antibiotics
klw01200  Carbon metabolism
klw01212  Fatty acid metabolism
Module
klw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DA718_27995 (fadB)
   00650 Butanoate metabolism
    DA718_27995 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DA718_27995 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DA718_27995 (fadB)
   00310 Lysine degradation
    DA718_27995 (fadB)
   00380 Tryptophan metabolism
    DA718_27995 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DA718_27995 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DA718_27995 (fadB)
   00281 Geraniol degradation
    DA718_27995 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DA718_27995 (fadB)
   00930 Caprolactam degradation
    DA718_27995 (fadB)
Enzymes [BR:klw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     DA718_27995 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DA718_27995 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     DA718_27995 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     DA718_27995 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: QBG10704
UniProt: A0A4P6NZ39
LinkDB All DBs
Position
5852263..5854452
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWREDGIAELVFDAPGSVNKLDTATVASLGQALDVLETQKDLKGLLLRSE
KAAFIVGADITEFLSLFLVPQEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRILGADSALEIIAAGKDVGADQALK
IGLVDGVVKHEKLIDGAIAILRQAINGDLDWKAKRQPKLEPLHLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENQSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDTETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKMAGVISTIQPTLDYAGFEHVDVVVEAVVENPKVKKAVLAETEDKVRP
DTILASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASLMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLADVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYDVPEGLRSKARHNEAYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacactctgtacctcgactggcgggaagacggcattgccgaactg
gtttttgatgctcccggttcggtcaacaagcttgataccgcaaccgtagccagcctcggt
caagcgctcgacgtactcgaaacacaaaaagatcttaaaggactgctgctgcgatctgag
aaagcggcctttatcgtcggcgcggatatcaccgaattcctttcactgttcctggttcct
caagaacagctcagccagtggctgcattttgccaatagcgtcttcaatcgtctggaggat
ttgccggtccctaccattgccgcagttaacggttatgcgttgggcggcggctgcgaatgc
gttctggcaaccgattatcgcctggcgacgcctgacctgcgcattggtctgccggaaacg
aagctcggcattatgccgggctttggtggttcggtgcgtatgccgcggatacttggtgcg
gacagtgcgctggaaatcattgccgccgggaaagacgtgggtgccgatcaggcattaaaa
atcggcctggttgatggtgtggttaaacatgagaaattgatcgatggcgcgatagcgatt
ctgcgtcaggccatcaatggtgatctggactggaaggccaagcgtcagccgaagctggag
cctcttcacctcagtaaaattgaagccacgatgagttttaccatcgccaaaggcatggtc
gcacaaaccgctggtaaacattatccagccccgattaccgctgtgaaaaccattgaagct
gccgcccgctttggtcgtgaagaagcgctgaacctggaaaatcagagttttgttccgctg
gcgcataccaacgaggcgcgggcgctggtaggtatcttcctcaacgatcagtacgttaaa
gcaaaagcgaagaagctcaccaaagataccgaaacaccaaaacacgctgccgtgctgggc
gcgggtattatgggcggcggcatcgcttaccagtcggcctggaaaggcgtgccggttgtc
atgaaggatatcaacgacaaatcgctgacgctcggtatgaccgaagccgccaagctgctc
aataaacagcttgagcgcggcaaaatcgacggtctgaagatggctggcgttatttccacc
attcagccaacgctggactacgctggttttgagcacgtggacgtggtggtcgaagccgtc
gttgagaacccgaaagtgaaaaaagcggtgctggcggaaactgaagataaagtgcgcccg
gataccatcctggcgtcaaacacttcgacgattccgattagcgaactggccagcgtcctg
aagcgcccggagaacttctgtggcatgcacttctttaacccggttcatcggatgccgctg
gttgagatcattcgcggcgagaaaagctcggacgaaaccatcgccaaagtcgttgcctgg
gcaagcctgatgggcaagacgccgattgtggtcaacgactgccccggcttctttgttaac
cgcgtgctgttcccctacttcgccggtttcagccagctgctgcgcgacggcgcggacttt
cgcaaagtcgacaaagtgatggagaagcagttcggctggccgatgggcccggcctatctg
ctggatgtggtcggtattgataccgcgcatcatgcccaagcggtcatggcggcaggcttc
ccgcagcgtatgcagaaagattaccgcgacgcaatcgatgccctgttcgacgcgagtcgt
ttcggtcagaaaaatggcctgggcttctggcgctataaagaagacagtaaaggcaagccg
aagaaggaagaggatgccgctgtcgatagcctgctggcagacgtcagccagccgaaacgc
gacttcagcgaagaagagattatcgcccgcatgatgatcccgatggttaacgaagtggtt
cgctgtctcgaagagggcatcattgccagcccggcggaagccgatatggcgctggtttac
ggcctcgggttccctccgttccacggcggcgcattccgttggctggatacgctcggcagc
gcaaaatatctcgatatggcgcagcaatatcagcatctcggcccactgtatgacgtgccg
gaaggcctgcgcagtaaagcacgccataacgaagcgtactatcccccggttgaacctgcc
cgcccggtaggcgacctgaaaacggcttaa

DBGET integrated database retrieval system