KEGG   Kushneria marisflavi: B9H00_01250Help
Entry
B9H00_01250       CDS       T04840                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
kma  Kushneria marisflavi
Pathway
kma00550  Peptidoglycan biosynthesis
kma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B9H00_01250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kma01002]
    B9H00_01250
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kma01011]
    B9H00_01250
Enzymes [BR:kma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B9H00_01250
Peptidases [BR:kma01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   B9H00_01250
Peptidoglycan biosynthesis and degradation proteins [BR:kma01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   B9H00_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 Transpeptidase DUF3658
Motif
Other DBs
NCBI-ProteinID: ART61858
UniProt: A0A240UK54
LinkDB All DBs
Position
complement(255885..257078)
Genome map
AA seq 397 aa AA seqDB search
MTLFAVNVCRWRHLVAFSSLALTLTAAPAMASDGPSPSSFIPSPPGLAAKSWVLMDAKSG
RVLVEHDADERVPPASLTKMMTAYIAESEIESGNMSPDDEVRISKEAWQTGGSRMFVKVN
SNVPVKDLMQGIVVQSGNDATVAMAEHIAGSQSSFADLMNEHARQMGLQNTHFMNPTGLP
DPGHYSSAHDMAIIARHIINDFPDHYSLYAEKYFTWNGIKQPNRNLLLWRDKSVDGLKTG
HTDEAGYCLVASALQSDTRLIAAVMGTNSEEARSQETQKLLSYGFRYFQTQKVYDAGQEL
TTARVWGGTQDEGSFGVANDVYLTASKQNEEGLSNRININGDLQAPIQAGQQYGTVQIVQ
NDEVIDEQPLVALESIEQGGLFKRLWDGLLKFVQGLF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttttgcagtaaacgtatgccgttggcgccaccttgtcgcgttttcctcactg
gcgctgacgctgacggcggcgcccgcgatggcatccgatggtccatccccctccagcttc
atcccttctccgcccggccttgctgcgaaatcctgggtgctgatggatgcgaagtccggc
cgtgttctggtcgaacatgatgccgacgagcgcgtaccgccggccagtctgaccaagatg
atgacggcctacattgccgaaagtgaaatcgaaagcggcaacatgtcgcccgacgatgaa
gttcgcatcagcaaggaggcctggcagaccggtggctcacgcatgttcgtcaaggtgaac
agcaatgtgccggtcaaggatctgatgcaggggatcgtggtgcagtcgggcaacgatgcc
acggtggccatggcagaacatattgccggtagccagtcttcgtttgccgatctgatgaac
gaacatgcccgtcagatgggtctgcagaacacgcatttcatgaacccgaccggtctgccg
gacccggggcactactcgtcagcacatgatatggccattatcgcgcgtcatatcattaat
gatttccccgatcattattcgctgtatgccgagaagtatttcacctggaacggcatcaag
cagcccaaccgtaatctgctgctgtggcgtgacaaatcggttgatggcctgaagaccggt
cataccgacgaagccggctactgcctggtggcttccgcactgcaaagcgacacccgcctg
attgcggcagtcatgggcaccaactcggaagaggcccggtctcaggaaacccagaagctt
ctgagctacggttttcgatacttccagacccagaaagtctatgacgctggtcaggaactc
acgacagcacgcgtctggggcggtactcaggacgaaggctccttcggcgtggccaacgat
gtctatctgacggcttccaaacagaatgaagagggactgtccaaccgcatcaacatcaat
ggcgatctgcaggcgcccattcaggccggccagcagtatggtaccgttcagatcgttcaa
aatgacgaggttattgacgaacagccgttggtagcactggaaagcattgagcagggcggt
ctgttcaagcgtctctgggatggccttctgaagtttgttcagggtctgttctag

DBGET integrated database retrieval system