KEGG   Kushneria marisflavi: B9H00_07115Help
Entry
B9H00_07115       CDS       T04840                                 

Definition
(GenBank) ribonucleotide-diphosphate reductase subunit alpha
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
kma  Kushneria marisflavi
Pathway
kma02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kma00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B9H00_07115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kma02000]
    B9H00_07115
Enzymes [BR:kma01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     B9H00_07115
Transporters [BR:kma02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    B9H00_07115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_23 DUF2813 AAA_16 DUF87 AAA_15
Motif
Other DBs
NCBI-ProteinID: ART64640
UniProt: A0A240UUF1
LinkDB All DBs
Position
1546634..1548184
Genome map
AA seq 516 aa AA seqDB search
MALLALESVSKSFPGVRALHDVSLKVEAGEIHALLGENGAGKSTLMKILCGIHQPDSGEI
LIDGHAQHFSSYRRACAAGVGIVFQEFSLIPGLSVVDNIFLGREPRNALGLIRHREMVDQ
AHALFERLGIDIDPLIRVHHLSVADQQFVEIAKALSLNARVLVLDEPTAPLTPTEVERLF
TIMRQLREQGVAMVFISHHMEEIFDICDRVTVLRDGEYVTTLNVTDTDAGALVEQMVGRR
VDNIFPERQTPPPADDIVLDARIRMTGRKHTDHIRLARGEILGFAGLVGSGRSEMALAMI
GAHPVAERHMRLEGDSVALKSPADALKRGIGLLPENRKQQGLILPFTCADNISINHLERF
QSSGPFISRRREQAAVETLMDCVRVKAPGSDTVVGTLSGGNQQKVVIARWLERGCRVLIF
DEPTRGIDVGAKSEIYALMKTLTAQGISIIMISSELPEITGLCDRVLVFNHGHVVAELAG
DEIEASTIMTHATRQISLDYPTGATDDTAATMEHAS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcgctactggcactggaaagcgtgagcaagagcttccccggcgtgcgcgcactgcat
gatgtcagcctcaaggtcgaggccggcgagatccacgccctgctgggggaaaacggcgcc
ggcaagtcgacgctgatgaagatcttgtgtggcattcatcagcccgacagcggcgagatc
ctgatcgacggccacgcccagcatttctcgagctatcgacgcgcctgcgccgccggtgtg
ggcatcgtctttcaggaattcagcctgattcccgggctcagcgtggtggacaacatcttt
ctcgggcgcgagccgcgtaacgccctggggctgattcgacaccgcgagatggtggatcag
gcccacgccctgttcgaacggctgggcatcgacattgatccgctgattcgcgttcatcac
ctgagcgtggccgaccagcagttcgtcgagatcgccaaggcgctatccctcaacgcccgg
gtactggtgctcgatgagcccactgccccgcttacccccaccgaggtcgagcggctcttt
accatcatgcgccagctgcgtgaacagggcgtggcgatggtgttcatctctcaccacatg
gaagagatcttcgatatctgcgaccgggtcaccgtgctgcgcgacggcgagtacgtcacc
acgctcaatgtaacggacaccgatgccggcgcgctggtcgagcagatggtcggccggcgg
gtcgacaacatctttcccgagcgccagacaccgccgcctgctgacgacatcgtgctcgat
gcccgcattcgcatgacaggccgcaagcataccgaccacatccgactggcccgcggcgag
atcctggggtttgccgggctggtcggctccggtcgcagcgagatggcactcgccatgatc
ggcgcgcatccggtggccgagcgtcacatgcgtctggaaggagattcggtcgcgctcaaa
tcaccggccgacgcgcttaaacgcggtatcgggctgttgccggaaaaccgcaagcagcag
gggctgatcctgcccttcacctgcgctgacaacatctcgatcaaccacctagaacgcttt
cagtcgtcaggcccgtttatcagtcggcggcgtgagcaggcagcggtcgagacgctgatg
gactgcgtgcgggtcaaggccccgggcagtgacaccgtggtcggcacgctctccggcggc
aaccagcaaaaggtggtcattgcccgctggctggagcgcggctgccgggtgctgatcttt
gacgagccgacccgcggcattgatgtcggcgcgaaatccgagatctatgcgctgatgaaa
acgctcaccgcccagggcatctcgatcatcatgatttcctcggagctgcccgaaatcacc
ggcctgtgcgaccgcgtgctggtcttcaaccacggccatgtcgtggccgaactggccggt
gacgagattgaggccagcaccatcatgacccacgccacccgccagatttcccttgattac
cccacgggtgccaccgacgacacggcggccaccatggagcacgcctcatga

DBGET integrated database retrieval system