KEGG   Kushneria marisflavi: B9H00_10800Help
Entry
B9H00_10800       CDS       T04840                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
kma  Kushneria marisflavi
Brite
KEGG Orthology (KO) [BR:kma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B9H00_10800
Enzymes [BR:kma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     B9H00_10800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NCD3G PALP
Motif
Other DBs
NCBI-ProteinID: ART64726
UniProt: A0A240UU99
LinkDB All DBs
Position
2383422..2384531
Genome map
AA seq 369 aa AA seqDB search
MSDTLTQNNVSQHEIPKTMHAVVAYGPGDYRYEEVPVPELDNDREILVKVEGCGICAGDI
KSFDGAPSFWGDEYQPAYIKAPMIPGHEFIGRVVKVGDAVKDYKPGDRVISEQIVPCWDC
RFCGRGQYWMCEKHDLYGFQSNVNGGMAEYMKFTKEAINYHVPEELPLEKAILIEPYACS
LHAVQRAKIELGDVVVLSGAGTLGLGMVGAAKKAGAEKLIVLDLFDERLELAKKFGADMV
LNPKNDDVVSIIKEMTGGYGCDVYIEATGHPKSVEQGLSMIRKLGRFVEFSVFKDPVSVD
WSIISDRKELDVLGSHLGPYCYPLVIDGIGNGDFPTEGVVTHKLPLEKFEEGFELMTSGA
KSLKIVLIP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacacactgacgcagaacaacgtctcccagcacgagattcccaaaaccatgcat
gccgtggtggcctatggtcccggcgactatcgctatgaggaggtgccggttcccgagctc
gataatgaccgcgagattctggtcaaggtcgaggggtgcggtatctgtgccggcgatatc
aagtcctttgatggcgccccgagcttctggggcgatgagtatcagcccgcctatatcaag
gcaccgatgattccgggtcacgagtttatcgggcgggtcgtgaaggttggcgatgccgta
aaggattataagcccggtgaccgtgtgatctccgagcagatcgtgccctgctgggactgc
cgcttctgtggtcgtgggcagtactggatgtgtgaaaagcacgatctctacggcttccag
agcaacgtgaacggcggcatggccgagtacatgaagttcacgaaagaggcgatcaactat
cacgtgcctgaagagctgccgctggaaaaggcgattctgatcgagccttatgcctgttcg
ctgcacgccgttcagcgcgcgaagatcgagctgggggatgttgtagtgctttccggggcc
ggcacgctggggctcggcatggtcggggccgccaaaaaggccggggccgaaaaactgatc
gtgctggatctctttgatgagcgcctcgaactggccaaaaaattcggcgcggacatggtg
ctcaatcccaaaaacgatgatgtggtgtcgatcatcaaggaaatgaccggcggttacggc
tgcgatgtctatatcgaagctaccggccatccgaaatcggtcgagcagggcctgtcgatg
attcgaaagctgggccgcttcgtcgagttcagcgtgttcaaggacccggtcagtgtcgac
tggagcatcatctccgatcgcaaggagcttgatgtgctgggctcgcatctggggccgtac
tgctatccgctggtgatcgacggcatcggcaatggtgatttccccaccgagggcgtggtg
acccacaagctgccgctggagaagttcgaggaaggctttgagctcatgaccagcggggcg
aagtcactgaagatcgtgctgatcccttaa

DBGET integrated database retrieval system