KEGG   Kushneria marisflavi: B9H00_13180Help
Entry
B9H00_13180       CDS       T04840                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
kma  Kushneria marisflavi
Pathway
kma00500  Starch and sucrose metabolism
kma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B9H00_13180
Enzymes [BR:kma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B9H00_13180
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     B9H00_13180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap EcKinase Glyco_hydro_77 hDGE_amylase HTH_6
Motif
Other DBs
NCBI-ProteinID: ART64781
UniProt: A0A240UTF7
LinkDB All DBs
Position
2890606..2894040
Genome map
AA seq 1144 aa AA seqDB search
MAAGEGEPAFIKDPLWYKDAVIYQVHVKSFYDANNDGIGDFQGLIERLDYIAGLGVNTVW
LLPFYPSPRRDDGYDISEYCAVSPDYGTLEQAQQFIEEAHARGLRVITELVINHTSDQHP
WFQRARHAPRDSPERDFYVWSDSDTHYSGTRIIFLDTETSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPVVFDEVMKVMHYWLEMGVDGLRLDAIPYLVEREGTNNENLPETHDVLKRIRT
VIDEHFPDRMLLAEANQWPEDTRPYFGEGDECHMAFHFPLMPRMYMSLAQEDRFPITDIL
RQTPEIPENCQWAIFLRNHDELTLEMVTDRERDYLWNHYASDRRARINLGIRRRLAPLLE
RDRRRIELLNSLLLSMPGTPTVYYGDEIGMGDNIHLGDRDGVRTPMQWSMDRNGGFSRAD
PASMVLPPIMDALYGFQTINVEAQTRDPHSLLNWTRRMLAVRSQQKAFGRGVMKLLYPKN
RRILAYIREYTHEDSGEVDSILCVANVSRSAQAVELDLSSWEGRVPVEMLGGSSFPPIGQ
LSYLLTLPPYGFYWFLLAPETAMPQWHTPAQEMMPELLTLVIKQRLEEVGSGRTRRSLEN
ESLPQYLPRRRWFASKNSTIDRVSLAWAVGLDGPVIDEYASGSPTILLGEIEVQSHQGNE
PSSHERYVLPLGMIGEDETSLLPQQLAMARIRRGREVGLLTDAFAMPGLPLAVVQALRAG
TVLDLSHSVVETDAEAPRPGELHFRSTSLLAEMEMSSQDAELRYLSAEQSNSSVIIDDRM
VLKLIRRIESGIHPEAEMGRYLTERGFNHIAPMLGEVTRVDDQGVPHVLMVLQGYIDNQG
DAWEWTLNTLERAIRDVSEMVQSEQEDAYDPLANLTGFAGLLGQRLGEMHTLLAMETPEA
DFAPEIADDARTQAWAESVRAQLARAMEILESHKGGASEEDQKLADWLLQRRESLYEMAD
SFAHHARGSLCTRTHGDLHLGQILVSHDDAYIIDFEGEPARSLDERRMKSSPLRDVAGVV
RSFDYASAMALDNAYRADVAHDREAVSQDVIEDYRHRVTQAFLLAYRQATHQVAHEWQFE
DGASAALSLFTLEKAAYEIAYEAANRPAWLSVPMRGLVALFDELSARSSNDMSQPGEGHH
DDSQ
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggagagggagaacccgcctttatcaaggatccgctgtggtacaaggacgcg
gtcatctatcaggtccacgtcaaatccttttatgacgccaataatgacggtatcggcgat
tttcaggggctgatcgagcgtcttgattacatcgcgggactgggcgtcaacaccgtctgg
ctgctgccgttttatccgtcgccgcgccgcgatgacggctatgacatctccgaatactgt
gcggtcagccctgattacggcacgctcgaacaggcgcaacagtttatcgaggaggcacat
gcccgcggcctgcgcgtcatcaccgagctggtcatcaatcacacctccgatcagcatccg
tggtttcagcgggcccggcatgcgcccagggactcgcccgagcgcgacttttatgtctgg
tcggacagcgatacccactacagcggcacccgcatcatctttctggataccgagacgtcc
aactggacgtgggatccggtggccggccagtacttctggcaccggttctactctcatcag
cccgacctgaacttcgataaccccgtcgtattcgatgaggtcatgaaggtcatgcattac
tggctggaaatgggcgtggatggtctgcgtctggatgccatcccgtatctggtcgagcgc
gaaggcaccaacaacgagaatctgcccgagacccacgacgtgctcaagcgcatccgtacg
gtgatcgatgagcattttcccgaccgcatgctgctggccgaggccaaccagtggcccgag
gacacacgtccctatttcggcgagggtgacgagtgccacatggcctttcacttcccgcta
atgcctcgcatgtacatgtcactggcacaggaagatcgcttccccatcaccgacattctg
cgccagacaccggaaattcccgaaaactgtcagtgggccattttcctgcgcaaccatgac
gagctgacgcttgaaatggtgaccgaccgcgaacgtgactatctctggaatcactacgcc
tccgatcgtcgtgcgcgcatcaatctgggcattcgacgtcgtctggcaccgctgcttgag
cgcgatcgccgtcgtatcgagctgctcaacagcctgttgctgtcgatgccgggtacaccc
acggtgtattacggcgatgagatcggcatgggggacaatatccacctgggggatcgcgac
ggtgtgcgtacccccatgcagtggtccatggaccgcaacggcggcttttctcgcgccgac
ccggccagcatggtactgccgccgatcatggatgccctgtacggttttcagaccatcaac
gtcgaggcgcagacccgcgacccccattcgctgctcaactggacacgccgcatgctggcc
gtgcgcagccagcaaaaggcgttcggtcgcggcgtcatgaagcttttgtatcccaagaat
cgacgcattctggcctacattcgcgaatacacccatgaggatagcggtgaggtcgattcc
atcctgtgcgtggccaacgtgtcacgctcggcacaggcggtggagctggacctttcaagc
tgggaagggcgtgtaccggtggagatgctcgggggcagcagcttcccgccgatcggacag
ctcagctatctgctgacgctgccaccctatggtttttactggttcctgctggcgccggag
acggccatgccgcaatggcacacgccggctcaggaaatgatgccggagcttttgacgctg
gtgatcaaacagcggctggaggaggttggttccggcagaacacgccgctcgctggaaaac
gaaagcctgccgcagtatctgccgcgaagacgctggtttgcctccaaaaacagcaccatc
gatcgggtctcactggcctgggcggtcggcctggatggcccggtcatcgatgagtacgcc
tccggctcgccgacgatattgctgggcgaaatcgaggttcagtcgcatcagggcaacgag
ccatcgtcccatgagcgctatgtgctgccattgggcatgatcggcgaggatgaaacgtcg
cttttgccacagcagctggccatggcccgcattcgccgcggccgggaagtcgggcttctg
accgatgcctttgcgatgccgggcctgcccctggcggtcgttcaggcgctgcgggcaggt
acggtgctggatctgagccatagcgtggtggaaacggacgccgaggcgccgcgtcccggc
gagctgcattttagatccacctcgcttctggccgagatggagatgtcatctcaggacgcc
gaactgcgttatctgagcgccgagcagtccaacagctccgtgatcattgatgaccgcatg
gtgctcaagctgattcgccggatcgaaagcggtatccatcccgaagcggagatgggtcgt
tatctgaccgagcgcggtttcaatcacattgcaccgatgctgggtgaagtcacccgcgtt
gatgatcagggcgtgcctcacgtgctgatggtgctgcaggggtatatcgacaatcagggc
gatgcctgggagtggacactcaacacgctcgagcgcgccattcgtgatgtcagcgagatg
gttcagtccgagcaggaggatgcctacgatccgctggcgaacctgaccggctttgcaggc
cttctgggacagcggctgggcgagatgcataccctgctggccatggaaacgccggaagcc
gattttgcccccgagatcgccgacgacgcccggacgcaggcatgggccgagagtgtgcgt
gctcagctggcccgggccatggagattctcgaaagccacaagggcggtgccagcgaagag
gatcagaagctggccgactggctgctgcagcgacgtgagtcactctacgagatggcggat
tcgttcgctcatcatgctcgtggcagcctgtgcacgcgtacccacggtgatctgcatctg
ggccagatactggtgtcgcatgacgatgcctacattatcgactttgaaggagagcctgcc
cgctcactcgatgagcgccgcatgaagagcagcccgttgcgcgatgtggcaggggtggtg
cgctcctttgactatgcctcggccatggcgctggacaatgcctatcgcgccgatgtggcc
catgatcgggaagcggtgagtcaggatgtcatcgaagactatcgtcaccgggtcacacag
gcgtttttgctggcctaccgccaggccacgcatcaggtggcccatgagtggcagttcgag
gatggtgccagtgctgcgctgtcgctgttcacattggaaaaggccgcttacgagattgcc
tatgaggccgccaatcggccggcatggctgagtgtacccatgcgaggtctggtcgcactc
tttgacgagttgagcgcccgctcgtccaacgacatgtcccaaccaggggagggtcatcat
gacgactcgcagtaa

DBGET integrated database retrieval system