KEGG   Klebsiella michiganensis RC10: VW41_00900Help
Entry
VW41_00900        CDS       T03782                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VW41_00900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kmi02000]
    VW41_00900
Enzymes [BR:kmi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VW41_00900
Transporters [BR:kmi02000]
 Other Transporters
  Pores ion channels [TC:1]
   VW41_00900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AJZ87701
UniProt: A0A0D5WNR5
LinkDB All DBs
Position
200526..201194
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWMLEELAQPYQIVRYQREPTMLAPEALKKIHPLGKSPVVEDNGH
ILAESGAILEYLQETYDSENSLKPQETNDKIQYRFWLHYAEGSLMPLLLMKLVFGSLGKA
PVPWPLRPVGNALGKGVQKAWLNKQITTHARFIEAHLSQHPWFAGQQFSAADIQMSFPVA
ALLARGEVNDMPHTHAWMKNVQTRPAWQRALNQGGPFEIPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctcacggttcatcacctcaataactcccgttcccagcgcgtactctggatgctggaa
gagctggcacagccctatcagatcgtgcgttaccagcgggagcccaccatgcttgccccg
gaagcgctaaaaaaaattcatccgttgggcaaatctcctgtagtagaagacaacggccat
attctggcggaatcaggcgccattcttgagtatctgcaggaaacctacgacagcgaaaac
agcctgaagccgcaggaaactaacgacaaaatccagtaccgattttggctgcattacgcc
gaagggtcgctgatgcccctgcttttaatgaagctggtgttcggcagcctcggcaaagcg
ccggtgccttggccgctgcgcccggtgggcaacgcgctggggaagggcgtccagaaagcc
tggctgaataagcaaatcaccacccatgcccgttttatcgaggctcacctgagccagcac
ccatggttcgccgggcagcagtttagcgcggcagatattcagatgagtttcccggtggcc
gcgctcctggccagaggtgaagtaaacgatatgccgcacacccacgcatggatgaaaaat
gtgcagactcggccggcctggcagcgagcactaaatcaagggggcccttttgagatccct
ggcgcgtga

DBGET integrated database retrieval system