KEGG   Klebsiella michiganensis RC10: VW41_02755Help
Entry
VW41_02755        CDS       T03782                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    VW41_02755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kmi03400]
    VW41_02755
Enzymes [BR:kmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     VW41_02755
DNA repair and recombination proteins [BR:kmi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     VW41_02755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AJZ88043
UniProt: A0A0D5WQ83
LinkDB All DBs
Position
573316..573822
Genome map
AA seq 168 aa AA seqDB search
MVSDILQPDLRVVFCGINPGKSSAHLGLPFAHPANRFWKVLHLAGFTDRQLKPEEAQLLL
SYGCGVTKLVERPTVQANEVALQELRAGGRELITKMQEYQPRALAILGKQAFEQAFRQRG
AKWGRQEVTLGDTEVWILPNPSGLSRITLDNLAAAYKELNVSLAARGR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggttagcgatatccttcagcctgaccttcgggtcgtgttctgcggcattaacccggga
aaatcatccgcccatctgggcttgccttttgctcatccagccaatcgcttctggaaggtg
ctccacctggcgggctttaccgaccggcagcttaagcctgaggaggcccagctgctgctt
tcctatggctgtggcgtgacgaaactggtggagcggcctacggttcaggcaaacgaagtg
gcactgcaggagctgcgcgccggtgggcgagagctgattacaaagatgcaggagtaccag
ccgagagcgctggcgattctgggcaagcaggcgtttgagcaggctttcaggcagcgtggt
gcgaaatggggccggcaggaggttaccctcggtgataccgaagtgtggattttacccaat
ccgagtggcttaagccgcattacgctggataatctagcggcggcctataaagagttgaat
gtgtcgctggcggcgcgtgggcggtaa

DBGET integrated database retrieval system