Klebsiella michiganensis RC10: VW41_02795 Help Entry VW41_02795        CDS       T03782                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism kmi  Klebsiella michiganensis RC10 Pathway kmi00790   Folate biosynthesis kmi01100   Metabolic pathways kmi01240   Biosynthesis of cofactors Module kmi_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:kmi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     VW41_02795 (folB) Enzymes [BR:kmi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      VW41_02795 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      VW41_02795 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      VW41_02795 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AJZ88049 LinkDB All DBs Position 581725..582093 Genome browser AA seq 122 aa AA seqDB search MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAGSDDVKDCLSYADVSEAV LQHVGGGRFALVERVAEEVAELLLTRFNSPWIRLKVSKPGAVAQAANVGVIIERGSNLKH SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggacattgtatttatagagcaactttcggtaatcaccactatcggtgtttatgactgg gagcaaaccattgaacagaagctggtgttcgatatcgaaatggcctgggataatcgcaaa gccgcgggcagcgatgatgttaaggattgtctcagctatgcggatgtcagtgaagccgtt ttgcagcacgttggcggcgggcgttttgcgctggtcgagcgagtggccgaagaggttgcg gaactgctgctgacccgctttaattctccgtggattcggctgaaggtcagtaagcctggc gccgtcgcacaggccgccaacgtcggcgtcattatcgagcgtggcagtaatctgaaacac agtaaataa

DBGET integrated database retrieval system