KEGG   Klebsiella michiganensis RC10: VW41_03105Help
Entry
VW41_03105        CDS       T03782                                 

Definition
(GenBank) TorR family transcriptional regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VW41_03105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kmi02022]
    VW41_03105
Two-component system [BR:kmi02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   VW41_03105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AJZ88104
UniProt: A0A0D5WPS7
LinkDB All DBs
Position
complement(643249..643965)
Genome map
AA seq 238 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILADNDINLVIMDINLPGK
NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGAISEERRSVESYKFNGWELDINSRSLVSPNGEQYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLQE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgcacattcttatcgtcgaagacgaattagtaacacgcaacacgcttaaa
agcatttttgaagcggaaggctatgatgtttttgaagcgaccgatggcgcagagatgcat
caaatccttgccgataatgacatcaacctggtcattatggacatcaacctgccgggtaaa
aacggcctgctgctggcgcgtgaattgcgcgagcaggctaacgtggcgctgatgttcctg
acgggtcgtgacaacgaagtggacaagatcctcggtcttgaaatcggtgcggatgactac
atcaccaaacctttcaacccgcgtgagctgactattcgtgcacgtaacctgctgtcccgt
accatgaacttaggggccatcagcgaagaacgtcgttccgttgaaagctacaaattcaac
ggctgggagctggacatcaacagccgctctctggttagcccgaacggtgaacagtataag
ctaccgcgcagtgaattccgtgcgatgctgcacttctgtgaaaacccgggcaaaattcag
tctcgtgctgagctgctgaagaaaatgaccggtcgcgagctgaagccgcatgaccgtacc
gtcgatgtcactatccgtcgtattcgtaaacatttcgaatccaccccggatacgccagaa
atcatcgcgaccatccacggtgaaggctaccgtttctgcggcgatctgcaggaataa

DBGET integrated database retrieval system