KEGG   Klebsiella michiganensis RC10: VW41_04505Help
Entry
VW41_04505        CDS       T03782                                 

Definition
(GenBank) beta-lactam-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
kmi  Klebsiella michiganensis RC10
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kmi01002]
    VW41_04505
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kmi01011]
    VW41_04505
Enzymes [BR:kmi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VW41_04505
   3.4.21  Serine endopeptidases
    3.4.21.-  
     VW41_04505
Peptidases [BR:kmi01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   VW41_04505
Peptidoglycan biosynthesis and degradation proteins [BR:kmi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VW41_04505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AJZ88353
UniProt: A0A0D5WR43
LinkDB All DBs
Position
complement(966775..967905)
Genome map
AA seq 376 aa AA seqDB search
MLAAALLPALSFAQPSPAPEFAADVVDRYANHIYYGSGATGMAIVVIDGNQRVFRSFGDT
RPGNNVRPQLDSVIRIASLTKLMTSEMLVKMLDQGKVQLNDPLSKYAPPGARVPTFNGQP
ITLINLATHTSSLPREQPGGAAHRTVFTWPTRDQRWNWLSQATLKAAPGTVAAYSNLAFD
LLADALSRATGRPYADLFDEQIARPLGMKDTTFTPSPDQCKRLMIAEKGASPCDNTLAAV
GSGGVYSTPGDMMRWMQQFLSSDFHHRGSQADRMQTLIYQRSQLHKVIGMDVPGKADALG
MGWVWMSPKEGRPGIIQKTGGGGGFITYMAMVPQNNVGVFVVVTRSPLTRFVNMSDGVND
LVTELSGNGAAVTPAS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgctggccgcagccctgcttccggcgctcagttttgcgcaaccgtcaccggcaccagaa
ttcgccgccgacgttgtcgatcgctatgccaaccatatttattacggcagcggtgcaacc
ggcatggccatcgtggtcatcgacggtaaccagcgggtgtttcgcagcttcggcgacacc
agaccgggcaataacgtgcgcccacagctggattcggttatccgcatagcctcgctgaca
aagctaatgaccagcgaaatgctggtaaaaatgctcgatcaggggaaggtccagctcaac
gatccgctcagcaaatatgccccccccggtgcccgggtaccgacctttaacggccagcca
attacgctgattaaccttgccactcacaccagctccctgccgcgtgaacagcccggtggc
gcagcgcaccgcacggtgtttacctggccaacgcgggatcaacgctggaactggctctca
caggccacgcttaaggccgccccaggcaccgttgccgcctattcaaacctggcgtttgac
ctgctggccgatgccctgtcacgagcaaccggcaggccatatgccgacctgttcgatgag
caaatcgcccgcccgctgggcatgaaagacaccacctttaccccttcgccagaccagtgc
aagcgcctgatgatcgccgaaaaaggcgccagcccttgcgataacacgctggcggcggtt
ggcagcggcggcgtttattctacgccgggcgacatgatgcgctggatgcagcagttcctc
tcttccgacttccatcatcgcggcagtcaggcagacagaatgcaaaccctgatttatcag
cgtagccagttgcataaggtcattggcatggacgtgccggggaaagccgacgcgctgggc
atgggctgggtatggatgtcgccgaaagagggccggccgggcattattcagaaaaccggc
ggcggcggcggctttatcacctacatggcaatggtgccgcaaaataacgtgggggttttt
gtggtggtcacacgctcgccgctgacccgctttgttaacatgagcgacggcgtgaatgat
ctggtgactgaactcagcggcaacggggccgcagtaacgcctgcatcctga

DBGET integrated database retrieval system