KEGG   Klebsiella michiganensis RC10: VW41_06105Help
Entry
VW41_06105        CDS       T03782                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00010  Glycolysis / Gluconeogenesis
kmi00260  Glycine, serine and threonine metabolism
kmi00680  Methane metabolism
kmi01100  Metabolic pathways
kmi01110  Biosynthesis of secondary metabolites
kmi01120  Microbial metabolism in diverse environments
kmi01130  Biosynthesis of antibiotics
kmi01200  Carbon metabolism
kmi01230  Biosynthesis of amino acids
Module
kmi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kmi_M00002  Glycolysis, core module involving three-carbon compounds
kmi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VW41_06105 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    VW41_06105 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VW41_06105 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmi04131]
    VW41_06105 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmi04147]
    VW41_06105 (gpmA)
Enzymes [BR:kmi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     VW41_06105 (gpmA)
Membrane trafficking [BR:kmi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    VW41_06105 (gpmA)
Exosome [BR:kmi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   VW41_06105 (gpmA)
  Exosomal proteins of melanoma cells
   VW41_06105 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AJZ88630
UniProt: A0A0D5WS07
LinkDB All DBs
Position
complement(1284453..1285205)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNILDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELSKDDERFPGHDPRYAKLTDSELPTTESLALTIDRVTPFWNESILPRMKSGERVI
VAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaagctggttctggttcgtcacggcgaaagccagtggaacaacgaaaac
cgcttcactggttggtatgatgttgatctgtctgataaaggtcgtaccgaagctaaagct
gccggtaagcttctgaaggacgaaggcttcactttcgacttcgcttacacctctgtgctg
aaacgtgccatccacaccctgtggaatatcctcgatgaactggaccaggcctggctgccg
gtcgagaaatcctggaaactgaacgagcgtcactacggcgcgctgcagggtctgaacaaa
gctgaaaccgctgaaaaatacggtgacgagcaggttaaacagtggcgtcgcggcttcgcg
atcaccccaccagagctgtctaaagacgacgagcgcttccctggccacgatccacgttac
gcaaaactgaccgacagcgaactgccaaccaccgaaagcctggcgctgaccatcgaccgc
gtaacaccgttctggaatgagtccattctgccacgcatgaaatccggcgagcgcgtcatc
gttgctgctcacggtaactccctgcgcgcgctggttaaatacctggataacctgagcgaa
gatgagatcctcgagctgaacatccctaccggcgtgccgctggtttatgagtttgatgag
aacttcaaaccgctgaaacgttactacctgggcaacgctgacgaaatcgcagcgaaagcc
gcagcagtagccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system