KEGG   Klebsiella michiganensis RC10: VW41_08505Help
Entry
VW41_08505        CDS       T03782                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00020  Citrate cycle (TCA cycle)
kmi00480  Glutathione metabolism
kmi01100  Metabolic pathways
kmi01110  Biosynthesis of secondary metabolites
kmi01120  Microbial metabolism in diverse environments
kmi01130  Biosynthesis of antibiotics
kmi01200  Carbon metabolism
kmi01210  2-Oxocarboxylic acid metabolism
kmi01230  Biosynthesis of amino acids
Module
kmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kmi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VW41_08505
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VW41_08505
Enzymes [BR:kmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VW41_08505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AJZ89071
UniProt: A0A0D5WSL3
LinkDB All DBs
Position
1802819..1804069
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGKKITLQNGKINVPHNPVIPFIEGDGIGVDVTPAMIKVVDAAVAKAYNGE
RKISWMEIYTGEKSTQVYGQDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
QLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDDCALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMEWFEAADLIVKGMEGAIEAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtcgttccggcggaaggtaaaaagatcaccctgcaaaatggcaaa
atcaacgttcctcacaacccggtgatcccgttcattgaaggggacggtatcggtgtggac
gtgacccctgccatgattaaagtggtggatgctgccgtggcaaaagcctacaacggcgag
cggaaaatttcctggatggaaatctacaccggcgaaaaatctacccaagtttatggccag
gacgtctggctgccagaagaaactctggacctgattcgtgactatcgcgtggccatcaaa
ggcccactgaccaccccagttggcggcggtattcgctccctgaacgttgccctgcgtcag
cagctggacctgtacgtttgtctgcgcccggtacgttactaccagggtaccccaagcccg
gtgaaacagcctgagctgaccgacatggttatcttccgtgagaactccgaagatatctat
gcgggtatcgagtggaaagcggacagcgccgaagctgacaaggttatcaagttcctgcgt
gacgaaatgggcgtgaagaaaattcgcttccctgagcactgcggcatcggcatcaagcct
tgctccgaagaaggcaccaaacgcctggtgcgtgcggccatcgaatacgctatcaccaac
gaccgtgattccgtgactctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagttcggcggcgagcttatcgacggc
ggcccgtgggtgaaaatcaagaacccgaacaccggcaaagagatcgttgtaaaagacgta
atcgccgatgcgttcctgcagcagatcctgctgcgccctgcggaatacgacgtgatcgcc
tgtatgaacctgaacggggactacatttctgatgccctggcggcacaggttggcggcatt
ggtatcgccccgggcgcaaacatcggcgacgactgcgcgctgttcgaagcgactcacggg
actgcgcctaagtacgcaggccaggacaaagtaaacccaggctccatcattctgtccgca
gaaatgatgctgcgtcatatggaatggttcgaagcagctgacctgatcgttaagggtatg
gaaggcgctatcgaagctaagaccgtaacttatgacttcgagcgtctgatggaaggcgct
aaactgctgaaatgttcagagtttggcgacgctatcattaaacacatgtaa

DBGET integrated database retrieval system