KEGG   Klebsiella michiganensis RC10: VW41_09550
Entry
VW41_09550        CDS       T03782                                 

Definition
(GenBank) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VW41_09550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmi01001]
    VW41_09550
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kmi02022]
    VW41_09550
Enzymes [BR:kmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VW41_09550
Protein kinases [BR:kmi01001]
 Histidine kinases
  OmpR family
   VW41_09550
Two-component system [BR:kmi02022]
 OmpR family
  RstB-RstA
   VW41_09550
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: AJZ89264
UniProt: A0A0D5WT14
LinkDB
Position
complement(2011095..2012390)
AA seq 431 aa
MKKLFVQFYLLLFVCFLVMTMLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPR
DWNKTINDLDLNLSFKLNIEPMSKFKLDDVAARHLREGEIVALDEEYTFIQRIPRSHYVL
AVGPIPYLFYLHQMRLLDIGLIAFIAISLAFPVFIWMRPHWQDMLKLESAAQRFGKGHLD
EHIHFDNASSFERLGIAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SEEESLALNRDIGQLEALIDELLTYARLDRPQTELHLAHVKFASWMETHIADVQLIHRQH
RITLETDTVTAIDYGALDLRLMERVTDNLINNALRYSQQQLRISLWREDDIANLQVEDDG
PGIPEEERARVFEPFVRLDPSRDRATGGCGLGLAIVHSIAVAMGGHVTIESSPLGGASFR
FSWPVNTTYLS
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaaaaagctgtttgtgcagttttatcttctgctgtttgtctgcttcctggtgatgacc
atgctggtcgggctggtgtataagtttaccgccgagcgggcaggccgccagtctctggac
gatttaatgaaaagttcgctgtacctgatgcgcagtgagctacgcgagatcccgccgcgg
gactggaataaaaccatcaacgatctcgacctgaacctctcttttaagctcaatattgag
ccgatgagcaagttcaaactcgatgacgttgccgctcgccacctgcgcgaaggcgaaatt
gtggcactggacgaagaatatacgtttatccagcgcattccgcgcagccactacgtgctg
gcggtaggcccgattccatatctgttttatctgcaccagatgcgactgctggatattggc
ctcatcgcatttatcgccatctccctcgccttcccggtgtttatctggatgcgcccgcac
tggcaggacatgctcaagcttgaaagcgccgcccagcgatttggtaaaggacatcttgat
gagcacattcattttgataacgcctcaagctttgaacgacttggcatagcctttaaccaa
atggcagataacatcaacgctttgattgccagtaagaaacagctgatcgacgggattgcg
cacgagcttcgcaccccgctcgtgcgcctgcgttatcgccttgaaatgagcgacaacctt
agcgaagaggaatcgctggcgctcaatcgagacatcggccaattagaagcgctgattgac
gagttgctaacctacgcccgtctcgacaggccgcagactgagcttcatctggcgcacgtc
aaatttgccagttggatggaaacgcatattgccgacgtacagctcattcaccgtcagcac
cggattacgctggagacagataccgtcaccgccatcgactatggcgcgctggatctgcgc
ctcatggaacgcgtcacggacaacctgatcaacaacgccctgcgttacagccagcagcag
ttgcgcatcagcctgtggcgagaagacgatatcgccaacctacaggttgaagatgatggc
cccggcattcccgaagaagaacgcgcccgggtatttgaacccttcgttcgcctcgatccc
agccgtgaccgggcaaccggcggttgcggccttggcctggcgatagtccactctattgcc
gtggcgatgggtgggcacgtcaccattgaaagcagcccattaggcggcgccagcttccgg
ttttcctggccggtcaataccacgtacctttcctga

DBGET integrated database retrieval system