KEGG   Klebsiella michiganensis RC10: VW41_16490Help
Entry
VW41_16490        CDS       T03782                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kmi  Klebsiella michiganensis RC10
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VW41_16490
Enzymes [BR:kmi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VW41_16490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO FAD_binding_3 Thi4 K_oxygenase NAD_binding_8 AlaDh_PNT_C Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AJZ90506
UniProt: A0A0D5WWS3
LinkDB All DBs
Position
3577278..3578846
Genome map
AA seq 522 aa AA seqDB search
MLDTTMKTQLKAYLERLTKPVELIATLDDGAKSSEVKELLAEIAELSDKVSFSINNDLPV
RKPSFLITNPGSSQGPRFAGSPLGHEFTSLVLALLQVGGHPSKESQELLAQIREIDGDFH
FETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGGVYQNEIQERNVMGVPAVYLNGKE
FGQGRMTLAEIVGKIDTGAEKRAADALNQREAYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSASKLIPAKTEG
GLHQIQTASGATLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKVRSLKNVDIVLNAQTLEVKGD
GSKVTGLQYKDRVTESVHDVALAGIFVQIGLLPNTTWLEGSVERNRMGEIIIDAKCETTV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTSAPE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaacaatgaaaacccagctcaaagcctatcttgagagactaacgaaacct
gttgagttgattgccacgctggacgacggcgcgaaatcatctgaagtaaaagaactgctg
gcagaaatcgctgagttatccgacaaagtttctttcagcattaataacgacctgccggtg
cgcaagccgtcgtttttgatcactaatccaggctcaagccagggcccgcgctttgcaggc
tccccgctgggtcacgaattcacttccctggtgctggcactgctccaggtcggcggtcac
ccgtccaaagaatctcaggagctgctggcgcaaatccgtgagatcgacggcgacttccac
ttcgaaacctattattccctctcctgccacaattgcccggacgttgtgcaggcgctgaac
ctgatgagcgtgttgaacccgcgcatcacccacaccgctatcgacggcggcgtttaccag
aatgaaattcaggaacgcaacgtgatgggcgtgcctgccgtctacctgaacggcaaagag
tttggccagggccgcatgacgctggctgaaattgtgggcaaaattgacactggcgcggaa
aaacgcgcggcggacgcgctgaaccagcgtgaagcttatgacgtactgatcgtcggcagc
ggccctgcgggcgcggcggcggcggtatatgcggcgcgtaaaggcatccgtaccggcctg
atgggcgagcgcttcggcggccaggtgctggataccgtggatatcgaaaactacatttcc
gtaccaaaaactgaaggccagaagctggcgggggcgctgaaagcccacgttgacgattac
gatgtggacgtgattgacacccaaagcgccagcaagctgatcccggccaaaaccgaaggc
ggcctgcaccagatccaaaccgcatcaggcgcaacgctgaaagcccgcagcatcatcgtg
gcaaccggcgccaaatggcgcaacatgaacgtgccgggtgaagatcagtaccgcaccaag
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgcgtggcggtg
atcggcggcgggaactccggcgtggaagcggccattgacctggcgggcatcgtcgagcac
gttaccctgctggaatttgccccggaaatgaaggccgaccaggtgctgcagaacaaagtg
cgcagcctgaaaaacgtcgacatcgtgctgaacgcccagacgctggaagtgaaaggcgac
ggcagcaaagtgaccggcctgcagtataaagaccgcgtgaccgaaagcgtgcatgacgtt
gccctggccggtatcttcgtgcaaatcggcctgctgccgaacaccacctggctggaaggc
agcgtggagcgcaaccgcatgggtgaaatcatcatcgacgcgaaatgcgaaaccaccgtg
aaaggcgtgttcgccgcgggcgactgcaccaccgtgccttacaaacagatcatcatcgcc
accggtgaaggcgcgaaagcttccctgagcgcgtttgattacctgattcgcacctcagcc
ccggaataa

DBGET integrated database retrieval system