KEGG   Klebsiella michiganensis RC10: VW41_17680Help
Entry
VW41_17680        CDS       T03782                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00071  Fatty acid degradation
kmi00280  Valine, leucine and isoleucine degradation
kmi00281  Geraniol degradation
kmi00310  Lysine degradation
kmi00362  Benzoate degradation
kmi00380  Tryptophan metabolism
kmi00410  beta-Alanine metabolism
kmi00640  Propanoate metabolism
kmi00650  Butanoate metabolism
kmi00903  Limonene and pinene degradation
kmi00930  Caprolactam degradation
kmi01100  Metabolic pathways
kmi01110  Biosynthesis of secondary metabolites
kmi01120  Microbial metabolism in diverse environments
kmi01130  Biosynthesis of antibiotics
kmi01200  Carbon metabolism
kmi01212  Fatty acid metabolism
Module
kmi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VW41_17680 (fadB)
   00650 Butanoate metabolism
    VW41_17680 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VW41_17680 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VW41_17680 (fadB)
   00310 Lysine degradation
    VW41_17680 (fadB)
   00380 Tryptophan metabolism
    VW41_17680 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VW41_17680 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VW41_17680 (fadB)
   00281 Geraniol degradation
    VW41_17680 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VW41_17680 (fadB)
   00930 Caprolactam degradation
    VW41_17680 (fadB)
Enzymes [BR:kmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VW41_17680 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VW41_17680 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VW41_17680 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VW41_17680 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 3HCDH_RFF
Motif
Other DBs
NCBI-ProteinID: AJZ90722
UniProt: A0A0D5WYJ1
LinkDB All DBs
Position
3833390..3835579
Genome map
AA seq 729 aa AA seqDB search
MLYQGETLHLDWLEDGIAELVFDAPGSVNKLDTATVASLGEALAVLEKQPNLKGLLLSSS
KSAFIVGADITEFLSLFLVPAEQLTHWLQFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIITAGKDVGAAEAQK
LGLVDGVVKTEKLRDGALAVLRQAIKGELDWQAKRAPKLQPLRLSKIEAGMSFTIAKGMV
AQIAGKHYPAPMTAVKTIEAAAGLGRDEALKLETQSFVPLARSNEARALVGIFLNDQFVK
AKAKKLTKDIETPQHAAVLGAGIMGGGIAYQSAWKGVPVLMKDINEKSLALGINEASKLL
NKQLERGKIDGMKLAQVISTIQPTLEYAGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DAVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDATLAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMASGFPQRMSKDYRDAIDVLFDAGRYGQKTQQGFYRFKEDSKGKP
RKEQDEAVDGLLADVSQPKRSFSEEEIIARMMIPMVNEVVRCLEEGVIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYFDMAQQYQNLGPLYVVPEGLKAKASRNEPYYPPVEPA
RPASDLKSA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggtgaaaccctacatctcgactggctggaagacggcatcgccgaactg
gtttttgatgcccccggctccgtcaacaagctggatacggcgaccgtcgccagcctcggc
gaagcgctggccgtacttgaaaaacagccaaacctcaaaggcctgctgctgagttccagc
aagtccgccttcatcgttggcgccgacattaccgaattcctgtcgctgttcctggtccct
gccgaacagctgacccactggctacaatttgcgaacagcgtgtttaatcgcctggaagac
ttgcctgtcccaaccatcgccgcggtgaatggctatgcgctgggcggcggatgcgaatgc
gtgctggcaaccgattatcgcctggcgacgccagacgcccgcatcggcctgccggaaact
aagctaggcattatgccaggcttcggcggctccgttcgtctgccgcgtttattgggcgcg
gatagcgcgctggaaattatcaccgcgggcaaagacgtcggcgcggcagaagcgcaaaaa
cttggcctggttgatggtgtggtaaaaaccgaaaaactgcgtgacggcgcactggctgtc
cttcgtcaggcaatcaaaggcgagctggactggcaggctaagcgcgccccgaaactgcag
ccgctacgcttaagtaaaatcgaagcgggtatgagtttcactattgctaaaggcatggtg
gcgcagatcgccgggaagcattatccagccccgatgaccgcagtaaaaaccattgaagcc
gccgcaggtcttggccgcgatgaagccctgaagctggaaacccaaagttttgtgccgctg
gctcgctccaatgaagcccgcgcgctggttggcatcttcctgaacgatcagttcgtcaaa
gccaaagcgaaaaaactcaccaaagatatcgaaacacctcaacacgcagccgtactcggc
gcgggtattatgggcggcggtattgcctatcagtcagcctggaaaggcgtgccggtgtta
atgaaagacattaacgagaagtcgctggcgctgggcattaatgaagccagcaagctgctg
aacaaacagcttgagcgcggcaaaattgacggtatgaagctggctcaggttatctctacc
attcagccaactttggaatacgccgggttcgaacgcgtagatgtcgttgttgaagccgtg
gttgaaaacccgaaagtgaaaaaagcggtactggcagaaaccgaagataaagttcgccct
gatgccgtgctggcctccaacacctccaccatcccgattagcgaactggcaagcgtgctg
aaacgtccggaaaacttctgcgggatgcacttcttcaacccggttcaccgcatgccgctg
gttgaagtcattcgcggagaaaaaacctcagacgctaccctcgccaaagttgtggcatgg
gcaagcaagatgggcaaaacccctattgtggtaaatgactgcccgggcttcttcgtaaac
cgcgtgctgttcccttactttgcaggctttagccagctgcttcgcgacggcgcagatttc
cggcagatcgataaagtgatggaaaaacagttcggctggccaatgggcccggcttacctg
ctggatgtggtcgggattgataccgcccatcacgcacaggcggtaatggcctcaggcttc
ccgcagcgtatgagcaaagattaccgcgatgcgattgacgttctgtttgatgccggacgc
tacggccagaaaacacagcagggcttctaccgctttaaagaagacagcaaaggcaaaccg
cgcaaagagcaggacgaagctgttgatggcctgctggcagatgtgagccagcctaagcgc
agcttcagcgaggaagaaattatcgctcgcatgatgatcccaatggtcaacgaagtggtt
cgctgcctcgaagaaggcgtgattgccagcccggcggaagccgatatggcactggtatac
ggcctcggtttccctccgttccacggcggtgcgttccgctggctggacaccctgggcagc
gcgaagtatttcgatatggcgcagcagtatcaaaatctcggcccgctgtacgtcgtgcct
gaaggccttaaggccaaagcatcacgcaacgagccctactatcccccggtcgagccagct
cgcccggccagcgatctgaaaagcgcctga

DBGET integrated database retrieval system