KEGG   Kryptolebias marmoratus (mangrove rivulus): 108229014
Entry
108229014         CDS       T05608                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108229014
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:kmr04052]
    108229014
Cytokines and growth factors [BR:kmr04052]
 Cytokines
  CSF and other factors
   108229014
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 108229014
NCBI-ProteinID: XP_017260155
LinkDB
Position
Unknown
AA seq 117 aa
FNSLPLFIFLEKALEQAQEVQTGLWLLQQALNLLRTSMTNTELHNHIDNSVRNLLSINAV
LRSLNIQEYTPPASAAGLQGTWQVSSAAELLQVHVNFLRGKVHLLLMDAQACRQNVS
NT seq 356 nt   +upstreamnt  +downstreamnt
acttcaactctctgcctctgtttatctttttggaaaaggcactggagcaagctcaggaag
ttcagacgggcttgtggcttttacaacaggccctcaacttactacggacgtcgatgacaa
acacggagctacacaaccacatagacaacagcgtcagaaacctgctcagcataaacgctg
tgctgcgaagtctcaacattcaggaatatactccaccagccagtgcggcgggactccagg
gaacgtggcaggtgtcctcggcagcggaactgcttcaggttcacgtcaacttcctgcgag
ggaaagtgcacctcctcctcatggacgcgcaggcttgtcggcaaaacgtcagctga

DBGET integrated database retrieval system