KEGG   Kryptolebias marmoratus (mangrove rivulus): 108229273Help
Entry
108229273         CDS       T05608                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00562  Inositol phosphate metabolism
kmr01100  Metabolic pathways
kmr04068  FoxO signaling pathway
kmr04070  Phosphatidylinositol signaling system
kmr04115  p53 signaling pathway
kmr04140  Autophagy - animal
kmr04150  mTOR signaling pathway
kmr04218  Cellular senescence
kmr04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108229273
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108229273
   04070 Phosphatidylinositol signaling system
    108229273
   04150 mTOR signaling pathway
    108229273
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108229273
  09143 Cell growth and death
   04115 p53 signaling pathway
    108229273
   04218 Cellular senescence
    108229273
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108229273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kmr01009]
    108229273
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108229273
    3.1.3.48  protein-tyrosine-phosphatase
     108229273
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     108229273
Protein phosphatases and associated proteins [BR:kmr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    108229273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 108229273
NCBI-ProteinID: XP_017260430
UniProt: A0A3Q3BJI4
LinkDB All DBs
Position
Unknown
AA seq 413 aa AA seqDB search
MAANLIKEIVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDS
KHKNHYKIYNLCAERHYDTSKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEQHV
AAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIYYN
FLLRNRLQYKPVALLFHKMMFETIPMFTAGTCNPQFVVYQLKVKIHTSNPAHTRREDKLM
FFEFPQPLPVCGDIKVEFFHKQNKMLKKEKMFHFWINTFFIPGPEETLDTLENGSAGTLR
ELSDRTHQNPAAGTTGGETSDRDFLVLRLNKNELDKANKDKANKNFSPNFKVKLFFTKTV
EEGANCDTSSTSASVTPDVSDNEPDHFRYSDTTDSDPENEPFEEDHHNQITKV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaacctaatcaaggagatcgtgagcaggaacaaaaggaggttccaggaggac
gggttcgatctggacctcacctatatttatccgaacatcatcgccatgggcttccctgcg
gagcgtctggagggagtttacaggaacaacatcgatgacgtggttcgatttttggattca
aagcacaagaatcactataagatctacaacctgtgtgcagagcgacattatgatacatca
aagttcaactgtcgggttgctcagtaccctttcgaggaccacaacccgccccagcttgag
ctaattaagcctttttgtgaggacctggatcagtggctgagcgaggacgagcagcatgtg
gccgccatccactgcaaggcaggaaaaggtcgcaccggagtcatgatctgcgcctaccta
ctgcaccgagggaagttccaggaggctcaagaggccctagacttctacggagaagtccga
actcgggacaagaagggcgtgaccatccccagccagcggcgctatgtgatctactacaac
ttcctgctgaggaaccggctgcagtacaaacctgtggctctgctcttccataagatgatg
tttgagaccatccccatgttcaccgcaggcacctgcaaccctcagtttgtggtgtaccag
ctgaaggtgaagatccacacatctaatcctgcccacacacggcgagaagacaagctgatg
ttctttgagttccctcagccacttcctgtctgcggagacatcaaggtggagttcttccac
aaacagaacaagatgttgaagaaggaaaagatgttccacttctggatcaacaccttcttc
atcccaggtccagaggagaccttggacacactggagaatggcagtgctgggacgctccgg
gaactgtctgacagaacccatcagaaccctgcagcgggtacgacaggaggtgaaaccagt
gacagggacttcctggttctaaggctgaacaaaaacgagttggacaaagctaacaaggac
aaagccaacaagaacttctccccaaattttaaggtcaaactgtttttcaccaagacggtg
gaggaaggagccaactgtgacaccagcagcacgtcagcttcggtgacgccggacgtcagc
gacaacgagccggatcacttccgctactcggacacgacggactcggacccagagaacgag
ccgttcgaggaggaccatcacaatcagatcacaaaagtctga

DBGET integrated database retrieval system