KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231052Help
Entry
108231052         CDS       T05608                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00590  Arachidonic acid metabolism
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108231052
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108231052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosducin An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 108231052
NCBI-ProteinID: XP_017263369
LinkDB All DBs
Position
Unknown
AA seq 906 aa AA seqDB search
MRASVLGSACALLLLLREPACQGDEVTVNPCCYLPCQHWGVCVRYGEAQYECDCTHTGYY
GENCTIPEFWTRVHQFLRPRPDVVHYILTHFHWFWDIINSSFLRNVLMRLVLTVRSNLIP
SPPTYNSKYGYLSWESYYNLSYYTRLLPPVPEDCPTPLGVKGRNGLPDPEVLVEKLLKRR
TFRPDPQGTNLMFAFFAQHFTHQFFKTYNRMGLGFTKALGHGVDAGHIYGDNLERQLNLR
LFKDGKLKYQLVDGEMFPPTVVDAPVRMSYPPEVPVQQQMAIGQEVFGLLPGLGMYATLW
LREHNRVCDILKAEHPTWDDEQLFQTTRLIVIGETIRIVIEEYVQHLSGYLLQLKFDPTL
LFHSNFQYGNRISLEFSLLYHWHPLMPDSFRVNGEELLYAQFLFNTSVLTHYGVEKLVDA
FSRQVAGQIGGGHNMNAVVTRVAVRTIEESRQLRVQPFNEYRKRFNLEPYTSFREFTDDE
EIASTLEQLYGDIDALEFYPGLLLEKTRPGAVFGESMVEMGAPFSLKGLMGNPICSPDYW
KPSTFGGKVGFDIVNSAMLKKLVCLNTRTCPYVSFRVPAEEKLGKDGGKVLSDELWRTAV
MTTLDDKLLGEKLQYYYSSSEDEGSDNEDEDGEKKTVRDAGVCEAEVDYSADGSSVNTGP
KGVINDWRKYKQLEVEQRQEQKNEMERLIKKLSMTCRSDLDLQKDQEKQKELQDKIKGKM
TMQEYNMLQEEKDDEDFLQHYRMQRIEEMRRQLCSGKRFKQVYELGGGEEFLEALDKEDK
STLIMIHIYEPDVPGCEAMSGCLMCLAQEYPLVKFCSVRSSAISISDLFRESALPALLVY
KGGDLIGNFVRLTDQLGEDFFAVDVEALLQECGLLPEKPPIVPKTVRNGAIIQSTVSDED
SDLDID
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctctgtcctgggatcagcttgtgctctcctcttgctgttgcgagagcctgcg
tgccagggggacgaggtcacagtgaacccatgctgttatctcccctgtcagcactggggt
gtgtgtgtgcgctacggtgaggcccaatacgagtgtgactgcacccacaccggctactat
ggagaaaactgcaccatccctgagttttggacccgagtgcatcagttcctccggccccgt
ccagatgtggtgcactacattctcacccatttccactggttctgggacatcatcaacagc
tctttcctacggaacgtcctcatgcggctggttttaacagtgagatccaacttgataccc
agccctccaacctacaactcgaaatatggctacctcagctgggagtcctactacaacctg
agctactacactcggcttctgccccctgttcctgaggactgccccacacctctgggggtc
aaaggcagaaatgggctgcccgaccctgaggtgctggtcgagaagctgctgaaaaggagg
acgttcagacccgacccccaaggcaccaacctcatgttcgccttcttcgctcagcacttc
acccaccagttcttcaagacctataatcgcatggggctgggcttcactaaggctctggga
cacggggtggatgcaggacacatttacggagacaacctggaacgccagctaaacctaagg
cttttcaaagatggaaaactgaaatatcagttagttgatggcgagatgttccctcccact
gtggtcgatgcccccgtcaggatgagctaccctcccgaggtccccgtccagcagcagatg
gccatcggtcaggaggtgttcggactccttcctggtttgggaatgtacgccacgctgtgg
ctcagggagcacaaccgggtctgtgacatcctgaaagcagaacatcccacctgggacgac
gagcagctgttccagaccacccgcctcatcgtcatcggtgagaccattcgaatcgtgatt
gaggagtacgtgcagcacctgagcggctacctgctgcagctgaagttcgaccccaccctg
ctgttccactctaatttccagtacgggaaccgcatctcgctggagttcagcctgctctac
cactggcaccctctgatgcccgacagcttccgcgtaaacggagaggagctgttgtacgca
cagttcctgttcaacacctctgttctcacgcactacggcgtggagaagctggtggatgct
ttctctcgacaagtcgctggtcagattggcggaggccacaacatgaacgctgtggtgacc
agggtcgctgtgaggaccatagaggagtcccgccaactgcgggtccagcctttcaacgag
tacaggaagcgtttcaacctcgagccctacacgtcgtttcgggagttcacggatgacgag
gagatagccagcacacttgaacagctctacggtgacatcgacgctcttgaattttatccc
ggattattgctggagaaaacacggccgggggccgtgtttggagaaagcatggtggaaatg
ggcgcccccttctccctcaagggcctcatggggaaccccatctgttcgccagattactgg
aagcccagcacctttggaggcaaagtcggctttgacatcgtgaactccgccatgctaaag
aagctggtctgtctgaacaccaggacgtgcccttatgtgtcattcagagttccagcagag
gaaaaactaggaaaggatggtgggaaagttctctctgatgagctatggcgaactgctgtc
atgactacgctggacgacaagctgctgggcgagaagctgcagtactactacagcagcagc
gaggacgaaggcagtgacaatgaagacgaagatggggagaagaagactgtccgggatgct
ggcgtctgtgaggccgaggtggactacagcgcagatggaagttctgtcaacacgggacca
aagggtgtgatcaatgactggaggaagtacaagcagctggaggtggagcagaggcaagag
cagaaaaacgagatggaaagactgataaagaagctgtcgatgacctgccgctccgatctt
gatctgcaaaaggaccaagagaaacagaaagagctgcaggacaagattaaaggcaaaatg
accatgcaggagtacaacatgctccaggaagaaaaggacgacgaagacttccttcagcac
taccggatgcagcgcattgaggagatgcggcgccagctctgcagcgggaagcgcttcaag
caggtctacgagctcggcggcggcgaggagttcctggaggcgttggacaaagaggacaaa
agcacactgatcatgatccacatctacgagccggacgtcccaggctgcgaggccatgagc
ggctgcctgatgtgcctggcgcaggaataccccctggtaaagttctgcagcgtgcgcagc
tcggccatcagcatcagcgacctgttcagagaaagcgccctgcccgctctgcttgtctac
aaggggggggacctgatcggcaacttcgtgcggctcacggaccagcttggggaagacttc
ttcgccgtagacgtggaggcactgctgcaggagtgcggcctgctgcccgagaagcccccc
atcgtcccgaagacggttcgcaatggagccatcattcagagcactgtgagtgatgaggac
tctgaccttgatatagactag

DBGET integrated database retrieval system