KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231137
Entry
108231137         CDS       T05608                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 108231137
NCBI-ProteinID: XP_017263509
UniProt: A0A3Q3F162
LinkDB
Position
Unknown
AA seq 365 aa
MSWGEFIELRDLRSTREQAALADARSPCSPPRLERTNALRISPGRVPDLLSRVGIIRVLS
STQDPQLPEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
RLDCSWDRGSVADHAGVVEHNVETDTNVDERTDSVKQELTTPEVLQKVKEYNAQINSNLF
MNMNKDGSYTGFIKVQFKLARPVSVPAPKKGGHDVGGRRASGVKRRTSFYLPKDASKHLH
ISSRTTSREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDEERPLRLRLCSGPN
EKVLSFVIKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIVQRYALARTKMQEALS
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggcgagttcatcgagctgcgggacctgaggtcgaccagggagcaggcggca
ctagcagacgcgcgttcaccatgctcgcccccacgcctggagaggaccaacgccctgagg
atcagccccggcagggtgccggatctcctgagccgggtgggcatcatccgggtcctgagc
agcacccaggacccccagctcccggaggagaagggggaggggcacaacttccagccctgc
agccacgctcagcccacgtggtgcgacctgtgcggagacttcatctggggcctttacaag
cagagcctgcggtgtgtcaactgcagattcacttgccactaccgctgtcgtgccctgatt
cgcctggactgcagctgggaccggggctctgtggccgaccacgccggtgtcgtggagcac
aacgtagagacagacacaaacgtggatgaacggactgattctgtaaagcaggagttgacc
acaccggaggttttacagaaggtgaaggagtacaacgctcagatcaacagtaatctgttc
atgaacatgaacaaagatggctcctacactggcttcattaaggttcagttcaagctggcg
cgacccgtgtcggtcccggctccgaagaaaggaggccacgatgtcggggggaggagggcc
agcggggtgaagcgtcgcacttccttctacctgccgaaggacgcgtccaagcatttgcac
ataagctcgcgtactacttcccgcgaggtcattgaggctttgctgaagaagtttaccgtg
gtggacaatcctggcaagtttgcactgtttgagcgcagcgagcgccacgaccaagtttat
gttcgcaagctctctgatgaagagcgccccctccgtctgcgcctgtgctctgggcccaat
gagaaagtcctcagttttgtcatcaaggagaatgaaactggtgaagtcaactggcatgcc
ttctccatgcccgagctgaagaacttcctgctcatcttgcagcgcgaggaagaggagcac
gtcaagcagatagtgcagcgctacgccttggcccgcactaagatgcaggaggccctgtcc
ggctcgacccccggctga

DBGET integrated database retrieval system