KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231156
Entry
108231156         CDS       T05608                                 

Gene name
tgfa
Definition
(RefSeq) LOW QUALITY PROTEIN: protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108231156 (tgfa)
   04012 ErbB signaling pathway
    108231156 (tgfa)
SSDB
Motif
Pfam: EGF EGF_2 Laminin_EGF
Other DBs
NCBI-GeneID: 108231156
NCBI-ProteinID: XP_017263536
UniProt: A0A3Q3AGT3
LinkDB
Position
Unknown
AA seq 248 aa
MFWILWDALFLLGGSLFTHGTGPSSSTIIKGNISIEANSTAAPNTSSSDSLTTAGEDAFT
TDIPTFKSSLISSEPWWTDPTAVDATVSVNATSAADLHNSTSSRMSTTKRPAGAASDRPV
KKFVAAAVHSRFDDCPDSHQHFCFHGTCRFLILEETPACVCHPGFVGLRCEHADLLAVVA
TNHRQQAVATVLVLCVIGCVLXHGVVLILTLLVEAGLSAAESCASLRDRKARSILLSTGE
CGLTRCFV
NT seq 747 nt   +upstreamnt  +downstreamnt
atgttttggattctctgggatgctctgtttctgctgggcggatctctttttacacatgga
acaggtccgagcagttcaacaatcatcaaaggcaacatttccatcgaggcaaactccact
gctgctccgaacacctccagcagcgactctttgacgactgctggcgaagacgcatttaca
actgatattcctacatttaaaagttctcttatttcatctgaaccgtggtggacggatcca
acagccgtcgatgctacagtctctgttaacgccacgtctgctgccgatcttcacaattca
acgagcagcagaatgtccacaactaaaagacccgctggggcggccagcgaccgcccagtt
aaaaagttcgtggcggcggctgttcactctcgtttcgacgactgtccagactcccaccaa
catttctgctttcatggcacgtgtcgcttcctgatactggaggagacgcctgcgtgtgtg
tgccacccaggcttcgtcgggttgaggtgcgagcacgcggacctgctcgccgtggtggcg
accaatcacaggcagcaggccgttgccacagtgctggtgctgtgcgtgatcggctgcgtt
ctcnatcatggtgttgtgctcattcttacattgctggtggaggcaggactgtcggcggcg
gagtcgtgcgcatctctacgtgacagaaaagcacggagcatcctgctatccaccggagag
tgtggtctgacgagatgtttcgtttga

DBGET integrated database retrieval system