KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231346
Entry
108231346         CDS       T05608                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
kmr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108231346
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108231346
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:kmr04030]
    108231346
G protein-coupled receptors [BR:kmr04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    108231346
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 108231346
NCBI-ProteinID: XP_017263849
UniProt: A0A3Q3AQF7
LinkDB
Position
Unknown
AA seq 372 aa
MGTETVCCEEGCYENRSVRFYYNNSNKIISDEWRKRDYVVVSLGFTVCFIVIFSNLLVMA
AIFKNRRFHFPIYYLLGNLALADFLSGVSYLHLMLHTGPWTIKLSIKQWFVRQGLIDTSL
TASVLNLLALAVERHQTIFSMQLHSSMSTRRVFIIIVCIWLVAIFIGLIPTMGWNCLCDL
KECSKMAPMYHHTFLMFWAVLNLLTFSIMVAIYTRIFLYVRRKSRQMSQHTSQIRHKETV
LSLMKTVSMILGLFVICWTPGLVLLLLDGLDCDRCQVLVFEKYVLVLAECNSFVNPIIYC
FRDSDMRRTFKDILCFLCNRHRDQNGLSEARFTTMDQENHNLRTIRRKEDTNGVPLVRQD
PDDSPDPPEERA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgggtacagagactgtatgctgtgaagaaggatgctacgagaatcgctcagtcaggttt
tattataataacagtaacaagattatcagtgacgagtggcgcaagcgtgactatgtggtt
gtcagtttgggatttactgtttgcttcatagttattttttccaaccttttggtcatggca
gccatttttaaaaaccgacgctttcacttccccatctactacctgctgggtaatctggct
ttagcagacttcctctcaggtgtctcctacctccatttgatgcttcacactggtccctgg
acaataaaactgtctatcaagcagtggtttgtgcgtcaggggctgattgacaccagcctc
acagcctcagtcctgaaccttctggcgctggctgttgagcgtcaccagaccatcttcagc
atgcagctccacagttcgatgagcaccagacgggtttttatcatcatagtatgcatctgg
ctggtggccatctttataggcctgattcccaccatgggctggaactgcctgtgtgaccta
aaggaatgctctaagatggcaccgatgtaccaccacaccttcctgatgttctgggctgtt
ctgaacttgctgaccttctccataatggtggccatctacacccggatctttctctatgtg
aggcgcaagagcaggcagatgtcacagcacacaagtcagatcagacacaaagagactgtg
ctgagcctgatgaagacggtttctatgattctaggcttgtttgtgatctgctggacaccc
ggcctcgtcctgctgctgctcgacggtctggattgtgaccgatgtcaggtgttggtcttc
gagaaatacgtcctggtgctggctgagtgcaactcgtttgtcaatcccatcatctactgc
ttcagagacagcgacatgaggaggacattcaaggacattttgtgcttcctgtgcaaccgg
caccgcgatcagaacggcttgtctgaagctcgctttaccaccatggatcaagagaatcat
aatcttcgtactatccggaggaaagaggacaccaacggggtccctctcgtacgtcaggac
ccggacgacagccccgatcctccagaggaacgagcgtaa

DBGET integrated database retrieval system