KEGG   Kryptolebias marmoratus (mangrove rivulus): 108232300Help
Entry
108232300         CDS       T05608                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00020  Citrate cycle (TCA cycle)
kmr00190  Oxidative phosphorylation
kmr01100  Metabolic pathways
kmr01200  Carbon metabolism
Module
kmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kmr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108232300 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108232300 (sdha)
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108232300 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 108232300
NCBI-ProteinID: XP_017265499
LinkDB All DBs
Position
Unknown
AA seq 663 aa AA seqDB search
MATVRAASRLLSKRVLSRAKAVPAAAVQGSRNFHFSIYGKKKSAKVSDDISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMDDGVCKGVIALCMED
GSIHRIRAQNTIIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIY
GAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEK
DHVHLQLHHLPPQQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQV
IDHTNGKDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTITDLHKPGEKL
TPLKPSAGEESVANLDKLRFANGSLRTSEIRLNMQKTMQNHAAVFRTGSVLKEGCDKMDD
VYQSMENIKTFDRGIVWNTDLVESLELQNLLLNAVQTINAAEQRKESRGAHAREDFKDRV
DEYDYSKPLEGQQKKTFDQHWRKHTLSYVDPKTGKVALKYRPVIDSSLNEQDCAHVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgttcgcgctgcgtcccgactgctctccaagagggtgctttcccgagcaaaa
gcagtccctgctgctgcagttcaaggttccaggaacttccacttctccatttatggcaag
aagaaaagtgccaaagtatcagatgatatctccacccagtatccagttgtggatcatgag
tttgatgcagtggttgtaggagccggaggagcaggacttcgggctgctttcggtctgtcg
gaggctggtttcaacactgcatgtgtcaccaagctcttccccaccaggtcacatactgtc
gctgcacagggagggatcaatgcagctcttggtaacatggaggaagatgactggcggtgg
catttctatgacacggtgaagggatctgattggctcggagaccaagatgctatccattac
atgacggagcaggctcctgcagccgtagtggagctggagaactttggcatgccattcagc
cgcactgaagatgggaagatctaccaaagagcttttggaggtcagagtctcaagtatgga
aagggaggccaggcccatcgctgctgctgcgtggcagacaggacagggcactcactgctg
catacgctttacggaaggtcccttcgctacgacaccagttactttgtggagtactttgcc
ctggacttgttgatggacgacggagtgtgtaaaggagtgatcgctctctgcatggaggat
gggtctattcaccgcatccgagcccagaacaccatcattgccactgggggttatggaaga
acttatttcagctgcacatctgcccacacaagcacaggagacggaacagccatggtgacc
agagccggcctgccctgccaggatctggagtttgtgcagtttcaccccactgggatctat
ggagccggctgcctgattacagagggctgtcgcggtgagggaggaatcctgatcaacagc
gagggggagcgcttcatggagcgttacgcccccaacgccaaagacctggcctcccgggac
gtggtgtcccgctccatgaccatagagatcagagagggcaggggcgtcggcccagagaag
gaccacgtgcacctgcagctccaccacctgcccccccagcagctggcctcgaggctgcct
gggatctcagagacggccatgatcttcgccggagtcgacgtcactaaagagcccatcccc
gtcttaccaacagttcattacaacatgggaggaatacccacaaactacaaggggcaggtg
attgatcacaccaacggtaaggacaaggtggtgcccggcctgtacgcctgcggtgaggca
gcttctgccagcgttcacggtgccaacaggctgggtgctaactccctgctggacctggtg
gtgttcgggagagcctgcgccctgactattactgatctgcacaagcctggagagaaactc
acccctctgaagcccagtgctggagaagagtccgtggccaacctggataagctgaggttt
gctaatggaagtctgagaacctctgagatccgactcaacatgcagaagaccatgcagaac
catgctgctgtgttccggaccggttctgttctcaaagagggatgtgataagatggacgac
gtctaccagagcatggagaacatcaagacctttgacagaggtattgtgtggaacacagac
ttggtggaatcgttggagctgcagaacctgttgctgaacgccgtccaaaccatcaatgca
gccgaacaaagaaaggagagcaggggagcccacgccagggaggacttcaaagatcgcgtc
gacgagtacgactactccaagcccctggagggtcagcagaagaagaccttcgatcagcac
tggagaaaacacactctgtcatacgtcgaccccaaaactggaaaggtggcgctgaagtac
cgtcctgttatcgacagctctctgaacgagcaggactgcgctcatgttcctccagccatc
cgctcctactaa

DBGET integrated database retrieval system