KEGG   Kryptolebias marmoratus (mangrove rivulus): 108233356Help
Entry
108233356         CDS       T05608                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04068  FoxO signaling pathway
kmr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108233356 (sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108233356 (sod2)
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108233356 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 108233356
NCBI-ProteinID: NP_001316311
UniProt: G4W8Z6
LinkDB All DBs
AA seq 225 aa AA seqDB search
MLCRVGQIRRCAASLNQSINQIAASRQKHTLPDLAYDYGALEPHVSAEIMQLHHSKHHAT
YVNNLNVTEEKYQEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPNGGGEPQGEL
MEAIKRDFGSFQKMKEKMSTATVAVQGSGWGWLGYEKDSGRLRIAACANQDPLQGTTGLI
PLLGIDVWEHAYYLQYKNVRPDYVKAIWNIINWENVNERLQMARK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcagagttggtcaaatacgcaggtgtgcagccagcctcaaccaaagcataaat
cagatcgccgcatcgaggcagaagcacaccctgcctgacctggcatatgattatggagcc
ctggagcctcatgtaagcgcagagataatgcagttgcaccacagcaagcatcatgccaca
tatgtcaacaatctcaatgtcacagaggagaagtatcaggaggctcttgcaaagggagat
gtaactgcacaagtctccctccagcctgctttaaagtttaatggaggaggccacattaac
cacaccatcttctggacaaacctctctcctaatggtggaggtgagccacaaggagagcta
atggaggccatcaaacgggactttgggtccttccagaagatgaaggagaagatgtccact
gctacagtggcggtgcagggctcaggctgggggtggctgggttacgaaaaggacagcgga
agacttcgcattgctgcttgtgctaatcaggatcccctgcaggggacaacaggtctgatc
cccctccttggcattgatgtatgggagcacgcctactatcttcagtacaaaaatgtgcgc
cctgactatgttaaagctatctggaatataatcaactgggagaatgtgaacgagcgtctg
cagatggccagaaagtag

DBGET integrated database retrieval system