KEGG   Kryptolebias marmoratus (mangrove rivulus): 108233632Help
Entry
108233632         CDS       T05608                                 

Gene name
itga2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04145  Phagosome
kmr04510  Focal adhesion
kmr04512  ECM-receptor interaction
kmr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108233632 (itga2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108233632 (itga2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108233632 (itga2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108233632 (itga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmr04147]
    108233632 (itga2)
   04515 Cell adhesion molecules [BR:kmr04515]
    108233632 (itga2)
   04090 CD molecules [BR:kmr04090]
    108233632 (itga2)
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108233632 (itga2)
  Exosomal proteins of bladder cancer cells
   108233632 (itga2)
Cell adhesion molecules [BR:kmr04515]
 Integrins
  Integrin alpha subunits
   108233632 (itga2)
CD molecules [BR:kmr04090]
 Proteins
  108233632 (itga2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS Integrin_alpha Big_5
Motif
Other DBs
NCBI-GeneID: 108233632
NCBI-ProteinID: XP_017267704
UniProt: A0A3Q3A7G6
LinkDB All DBs
Position
Unknown
AA seq 1186 aa AA seqDB search
MEPFWGKVFFALVVFSDRICLSLSFNVGTAGAKIFSGPAAEEFGYTVQQAADIRDKWLLV
GAPWSGFTANRKGDVYKCPISGSRNSCDKLNLQNSVSMPDVKNVNSNMSLGLTLTRMSSV
VISDFMTCGPLWGQQCGDQNFYPGICAKLNPLFQLQPAFSPAVQTCGGPMDIVIVLDGSN
SIYPWKPMTEFLLKLIPSLDIGPQSTQISVIQYAVDPSVEFKLNQYKTKDEINKAASRIT
QKYGLETNTFRAVKYASEYGFHVTNGGRPGAAKVMVVVTDGESHDYDLKDSVIAQCQKQG
ITRFGIAVLGYYIRNNIDTKNLIEEIKSIASLPTEKFFFNVSEEAALSTIAGTLGNRIFN
IEGTGKEGENFQMEMSQVGFSTHYSKQQDVMMLGAVGAYAWSGTVVHQTGSKVTIFPFSA
FEESLQDRNHSSLLGYSLTTLSDGSTEYFVAGAPRSNHSGQVIVYTVNAEKKISVKDSER
GKQIGSYFGSVLCSLDVDKDGVSDLLLVGAPMYMSDLKREEGRVYLFSVTKGILNEQGFL
TGPAPNENARFGMAISAVPDLDLDGYLDVVVGAPLEENRKGVIYIYNGNEKTLNKQFSQR
ILGSKLDPHLQYFGRSLDSFKDLNDDTIPDISIGAYGKVVQLWSRGVGVVTATATFSPDK
INIFDKLCDINGRKHSCFNTNVCLKASFRPKTPVGPINVSYTFTLDADLQGSRVTSRGLF
TKNNERYLKGKADISSAPLCFDNQVYVQETPDFVNSLSLKVEVKQESEDVNPVLDVFSPS
AFEFFIPFTKDCGLDNMCVSDLVLSVKTNTKASSSAPFLVSANNRGLSFEVAVKNKKENA
YNTQVTAKFSSNLYYSSVSPTDEVKCTATQQDAVTCQVGYPVIKENHEVKFQITFDYSFE
QLQSHADVEFEAKSDGREENPADNNKHISIPLQYDSGIVLSKESNMNFYVANMSGHVVTT
VKTLDDIGPEFNFTVKVSTGSFPVSLLYLTIALPMNTKGGNQLLYLTSVETQAGGSVSCD
SSRLVDPLQIGDRSHTVSFSEESFRGLEKLDCKSAKCESIKCILKDTEVKSSYFVKVKTR
IWRGTLITASYQSIKLTSSLDVETSNPDLLIIGLKQQNVVLTVSKPGEKADVPVGVIAGS
VIAGLLLLAGAVALLWKVGFFKRKYQKLRKDADEDGPSQPHVDEVL
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttctgggggaaagtcttcttcgctttggtagttttttctgacaggatctgc
ctctcgctgtctttcaacgtcggcactgcaggagctaagattttcagcggcccagcagcc
gaggagttcggctacacggtgcaacaagcggcagacatccgggacaaatggctcctggtt
ggtgctccatggagcggtttcactgcaaacaggaagggggatgtttataagtgtccaatc
tcaggatcaagaaacagctgtgacaaactcaatcttcaaaattctgtcagtatgccagat
gttaaaaatgtcaacagtaacatgtctctgggtttgactcttacccggatgtcatcagtg
gtaatcagtgattttatgacgtgtggtccactctgggggcagcagtgtggagatcagaac
ttttacccaggaatatgtgcaaaactgaacccgctttttcaacttcaacctgccttctct
cccgctgttcaaacatgtggagggccgatggacattgtgattgttctggatggctcaaac
agcatttatccctggaaaccaatgacggagttcctgctgaagttaattccctccttagac
atcggcccccaaagtacacagatcagtgtcatccagtatgcagttgaccccagcgttgaa
ttcaaactgaatcaatataaaactaaagatgagattaataaagcggcgtccagaatcacc
cagaagtatggcttagaaacaaatacatttcgcgcagtcaagtatgccagtgagtatggt
ttccatgtgaccaatggtggccgacctggtgccgccaaagtaatggtggttgtcactgat
ggcgagtcccacgattatgatctcaaagacagtgtaatcgctcagtgtcagaaacaaggc
atcacccgatttggcattgcagtcttgggttattatatcagaaacaacatagataccaaa
aaccttattgaagaaatcaaatccattgctagtttacccacagagaagttcttcttcaat
gtgtcagaggaggcggctctatcaacgatcgctggaactttggggaaccgcatcttcaac
atagaaggtacggggaaagaaggtgaaaacttccagatggagatgtctcaggttggattc
agcactcattattccaaacagcaggatgtgatgatgcttggagctgtgggagcatacgct
tggagcgggaccgtcgtccatcagaccggttctaaagtgaccattttcccattctcagcc
tttgaggaatcactgcaagacagaaatcacagctcgttattgggctattctctaaccacc
ctgagtgatgggtccacagagtactttgtggctggtgcacctcgttccaaccactctgga
caagttattgtttacaccgtcaatgctgagaagaaaattagtgtcaaagattcagagaga
gggaaacagattggctcctactttggcagtgttctgtgctcgctggacgtggacaaggat
ggggtgtcagaccttcttctggttggggcacccatgtacatgagtgacctgaagagagaa
gaaggcagagtctatttattctctgtcaccaagggtatactgaatgagcagggattcctc
actggtccagccccgaatgaaaatgctcgttttggaatggccatttctgctgttcctgat
cttgacctggatggttaccttgatgttgtggttggagcaccactggaagaaaacagaaag
ggagtcatttacatctacaatggaaacgagaagacattaaacaaacagttctcccagaga
atccttggctcaaaacttgatcctcaccttcagtattttggaagatctcttgatagcttc
aaagatctgaatgatgataccattcctgacatctccatcggtgcttatggcaaagtggtc
cagctctggtccagaggagtgggagtcgttacagctacagctaccttcagccctgataaa
atcaacattttcgacaaactctgtgacattaacggacgtaaacattcatgcttcaacacc
aacgtctgccttaaagcttcgttcagacccaagacacctgtggggcccatcaatgtttca
tacactttcaccctggacgccgacctgcagggttcacgggtgacatcaagagggctgttt
accaaaaacaacgaacgttacctgaaagggaaggcggatatatcctcagcgcccctgtgt
tttgacaaccaggtttatgttcaggaaacgcccgactttgtgaattccctcagtctgaaa
gtagaagttaagcaggagagtgaggatgtgaacccagtcctcgacgtgttttctccaagt
gcctttgaattctttatccccttcacaaaagactgtgggttggacaacatgtgtgtcagt
gatttggttctgagtgtgaagacgaacacaaaggcatccagttcagctcctttcctggtc
agcgctaataacagaggcctatcgtttgaagttgctgtgaagaacaagaaagaaaatgct
tacaacacacaagtcacagccaaattctccagcaacctctactactcatctgtttctcct
acagatgaagtcaaatgcacagcgacacaacaagatgctgtcacttgtcaagttggttac
ccagtaattaaagaaaaccatgaggtgaaatttcagatcacttttgattacagttttgag
cagttgcaaagccacgctgacgtcgagtttgaggctaaaagtgatggcagagaggaaaac
cctgcagacaataataagcacatatccattcctttgcagtatgactcagggatcgtgtta
tccaaggagtcaaacatgaacttttacgtggcaaatatgtcgggtcatgtggtgacgaca
gtgaaaactctggatgacatcggcccagagtttaacttcacagtcaaggtttcaacaggt
agcttccctgtcagcctcctgtatctgaccatagcgctgccaatgaacactaaaggtgga
aaccagcttctctatctgaccagtgtggaaacacaagcaggaggatctgttagctgtgac
tccagccgtctagttgatcctctgcagatcggagacaggagccatacggtttccttctca
gaggagagcttcagaggcctggagaaactggactgcaaaagtgcaaaatgtgaatccata
aagtgcatccttaaagacactgaagttaagagcagctactttgtgaaagttaaaacaagg
atctggagagggacgctcattacggcctcctatcagtccatcaagctgacctccagtctg
gatgtggagacctccaacccagacctgctcattattggcctcaaacagcaaaatgtggtg
ctgacagtcagtaaacctggagagaaggctgatgttcctgtgggagtgatagctggcagc
gttatcgccgggctgctgctgttggctggggctgttgcactgctgtggaaggtcgggttt
tttaaaagaaagtaccagaagcttcggaaggacgctgatgaagatgggccaagccagccg
cacgttgatgaagtgctgtga

DBGET integrated database retrieval system