KEGG   Kryptolebias marmoratus (mangrove rivulus): 108234078Help
Entry
108234078         CDS       T05608                                 

Gene name
gstz1
Definition
(RefSeq) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00350  Tyrosine metabolism
kmr01100  Metabolic pathways
Module
kmr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108234078 (gstz1)
Enzymes [BR:kmr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     108234078 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 108234078
NCBI-ProteinID: NP_001316300
UniProt: E6Y352
LinkDB All DBs
AA seq 216 aa AA seqDB search
MATQTKPVLYGYFRSSCSWRVRIAFALKGIEYDQVPVNLIKDGGQQLKEQYKALNPMQQV
PAVEIDGITLSQSLAVIQYIDETRPGPRLLPTDPKARAQVRIISDLIASGIQPLQNLYVL
QKIGAEKVQWAQHFINRGFQALEPILKQISGKYCVGDEISMADICLVPQVYNAERFKVDV
EQYPTIKRLNETLLETEAFKVSHPSRQPDTPADLRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaaacaaagcctgtactttatggatacttcagaagttcctgctcctggagg
gtccgcattgcttttgctcttaaaggcattgagtatgaccaggttccagtcaatctcatc
aaagacggagggcagcagcttaaagagcagtataaagctctgaacccaatgcagcaagta
cctgcagtggaaatagatggcatcactctctctcaatcactcgcagtgatccagtacatt
gatgagaccagaccgggacctcgtcttcttcctacagacccaaaggcacgtgctcaggtt
cgaataataagcgacctcattgcctctggaattcagcctctgcagaatttgtatgtgctc
cagaaaataggagcagagaaggtacaatgggcgcagcacttcattaaccgtggttttcaa
gctctagagccgattctgaagcaaatctctggcaaatactgtgtaggtgacgagatttcc
atggcagatatttgtctggtgcctcaggtctataatgcagagaggtttaaagtggacgtc
gagcagtatccaacaatcaaaagattaaacgagaccctacttgagaccgaagctttcaaa
gtgagtcatccatctcggcagccagatacccctgctgatcttcgagcatga

DBGET integrated database retrieval system