KEGG   Kryptolebias marmoratus (mangrove rivulus): 108234102Help
Entry
108234102         CDS       T05608                                 

Gene name
got1
Definition
(RefSeq) aspartate aminotransferase, cytoplasmic
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00220  Arginine biosynthesis
kmr00250  Alanine, aspartate and glutamate metabolism
kmr00270  Cysteine and methionine metabolism
kmr00330  Arginine and proline metabolism
kmr00350  Tyrosine metabolism
kmr00360  Phenylalanine metabolism
kmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kmr01100  Metabolic pathways
kmr01200  Carbon metabolism
kmr01210  2-Oxocarboxylic acid metabolism
kmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108234102 (got1)
   00270 Cysteine and methionine metabolism
    108234102 (got1)
   00220 Arginine biosynthesis
    108234102 (got1)
   00330 Arginine and proline metabolism
    108234102 (got1)
   00350 Tyrosine metabolism
    108234102 (got1)
   00360 Phenylalanine metabolism
    108234102 (got1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    108234102 (got1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kmr01007]
    108234102 (got1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108234102 (got1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmr04147]
    108234102 (got1)
Enzymes [BR:kmr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     108234102 (got1)
Amino acid related enzymes [BR:kmr01007]
 Aminotransferase (transaminase)
  Class I
   108234102 (got1)
Membrane trafficking [BR:kmr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    108234102 (got1)
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108234102 (got1)
  Exosomal proteins of other body fluids (saliva and urine)
   108234102 (got1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 108234102
NCBI-ProteinID: XP_017268523
UniProt: A0A3Q3BQK6
LinkDB All DBs
Position
Unknown
AA seq 410 aa AA seqDB search
MSVFWEVPLAVPVAVFKLTQDFNNDQFPKKVNLGVGAYRTDEGKPWVLPVVKKVEKLIVH
DDRLNHEYLPILGLPDFRSSASKIALGDDSLAIQEDRVGAVQCLGGTGALKIGAEFLRRF
YNGTNNTKTPVYVSAPTWENHNAVFSNAGFEDVRPYKYWDAEKRGLDLAGFLGDLESCPE
RSVFVLHACAHNPTGTDPTKEQWKQIAEVMKRRKLFVFFDSAYQGFATGSLEKDAWAVRY
FVSMGFEMFCAQSFSKNFGLYNERVGNLTIVSRDADKLKRVLSQMEKIVRTTWSNPPSQG
ARVVAVTLNSPELFSEWRDNVKTMADRVLLMRAQLKAKLQTLGTPGTWDHITNQIGMFSF
TGLNSKQVEYLIKEKHIYLLASGRINMCGLTSKNIDYVAESIHEAVTKVQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttttgggaggtccccctggcagtacccgtagctgtctttaagttaacgcag
gacttcaacaacgaccagtttcctaaaaaggtgaacctgggagttggagcctacaggaca
gatgaaggcaaaccttgggttttgccagtggtgaaaaaggtggagaagctcattgtgcac
gatgaccggctaaaccacgagtacctgcccatcctggggctgcctgacttcagatcctct
gcctccaagatcgcgctgggagacgacagtcttgccatccaggaggacagggtgggggcc
gtccagtgtcttggcggtaccggcgctttgaagataggcgcagaatttctgaggcggttc
tacaatgggacgaacaacacaaaaacacccgtctatgtttctgcacctacttgggaaaat
cacaatgccgtgttcagcaatgctggcttcgaggacgttcgtccttacaagtattgggat
gcagaaaagagaggtctggacttggctggttttcttggagacctggagagttgtccagag
cgctcagtctttgtcctacatgcttgtgcccataatcccaccggaacagaccccacaaag
gagcaatggaagcaaattgctgaggtcatgaagaggagaaagctgtttgtgttctttgac
tcggcctatcaaggctttgccacaggcagtctggagaaagatgcctgggctgttcgctac
tttgtctccatgggctttgaaatgttttgcgctcagtcattctccaagaactttggcctc
tacaatgagcgtgtaggcaaccttacgatcgtctctcgtgatgctgacaaactgaagcgg
gtcctctcccagatggagaagatagtcagaaccacctggtccaacccgccttctcaggga
gctcgcgtcgttgccgtcacgctcaactcaccagagctcttttctgaatggagggacaat
gtaaagaccatggctgacagagttttactgatgagggctcagctgaaagccaagcttcag
actctgggcacaccagggacctgggaccacatcactaaccagattggcatgttcagcttc
acgggtctcaactccaaacaagtagaatacctgataaaagagaaacacatctatttattg
gccagtggtcgcatcaacatgtgtggcttgaccagcaagaacatcgactacgtggccgag
tccatccacgaggccgttaccaaggtgcagtag

DBGET integrated database retrieval system