KEGG   Kryptolebias marmoratus (mangrove rivulus): 108235061
Entry
108235061         CDS       T05608                                 

Definition
(RefSeq) uncharacterized protein LOC108235061
  KO
K05461  KIT ligand
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108235061
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108235061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:kmr04052]
    108235061
Cytokines and growth factors [BR:kmr04052]
 Growth factors
  Growth factors (RTK binding)
   108235061
SSDB
Motif
Pfam: SCF DUF2771
Other DBs
NCBI-GeneID: 108235061
NCBI-ProteinID: XP_017270274
UniProt: A0A3Q3ALP6
LinkDB
Position
Unknown
AA seq 253 aa
MRKKIFNTTCFLLSLLSNLNLCSEKFGTPITDDVNKLSILKQNIPSDYEIPVSRIPKEVA
GTCWVVLNIYPLEQSLQKFANMFGTVSSNKDNIMVFITMLKSLRFTFDHEELETAMQVFR
CHYQEESLQSGLYFDYIQDLLHTATQGRSSLSCKPQTCLNRQLTPEGQEESHRQSWSKRA
PLLLVLIPFTASVVLIVWQVKSGGRLPACNTLNGQMATPDMIPTVSISIPLQTLTHAADS
QPAGEAISEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttcaacacaacttgtttcctcctgagtttgttatcaaatttaaat
ctctgttctgaaaagtttgggacacccataactgacgatgtgaacaagctgtcaatattg
aagcagaatattccctctgattatgagattcctgttagccgcattcccaaagaagtggcc
ggcacatgctgggtggttttaaatatctatcctttggagcaaagtcttcaaaagtttgcc
aacatgtttggtaccgtctcctccaacaaagataacataatggtctttatcacgatgctc
aagagcctacgcttcacctttgaccacgaggaactggaaacagcaatgcaggtcttccgc
tgtcattaccaggaagagagcttacagtctggtctttacttcgactacatccaagacctc
ttacatactgccactcaaggaagatcaagcctctcatgcaagccacagacatgccttaat
cgccagctaacaccagagggtcaggaggagagtcacagacaaagctggtcaaagagagct
ccgttgcttttggtgctgattcccttcacagcttctgttgttctcatagtgtggcaggtc
aaatccggaggccgtttaccagcgtgcaacactttaaacggccaaatggcaactcctgac
atgatcccaactgtgtctatctccatcccacttcaaacactcacccacgccgctgacagt
cagccagcgggggaggcaatctcagaacatgaaagtggatga

DBGET integrated database retrieval system