KEGG   Kryptolebias marmoratus (mangrove rivulus): 108235074
Entry
108235074         CDS       T05608                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04020  Calcium signaling pathway
kmr04260  Cardiac muscle contraction
kmr04261  Adrenergic signaling in cardiomyocytes
kmr04270  Vascular smooth muscle contraction
kmr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108235074
   04020 Calcium signaling pathway
    108235074
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108235074
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108235074
   04261 Adrenergic signaling in cardiomyocytes
    108235074
   04270 Vascular smooth muscle contraction
    108235074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:kmr04040]
    108235074
Ion channels [BR:kmr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108235074
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 108235074
NCBI-ProteinID: XP_024861394
LinkDB
Position
Unknown
AA seq 2376 aa
MLRGLFQRKLKHERLEEEPEVRYKGVLVSEKDLGYKFVRPGGSDYSPPPPLPRPPPAGLA
NEHRGGGSHGDHSGGGGGVNHGVGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNASA
GGGAGLGSGGGGPISTASSTQRKRQHYTTKPKKQTTTTATRPPRALLCLTLKNPIRRACI
SIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKV
IAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTC
THTHNLSGANAEEKPAPCAPDGAYGRHCMQNGTKCQGGWEGPNEGITNFDNFAFAMLTVF
QCITMEGWTDVLYWVNDAVGYRWPWVYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKA
RGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNRISPAQLTKKTRKL
AWFSHSADSQDVSMPASENESVNTDNAPGGDVEGETCCTRLAIRISKSKFSRYSRRWNRL
CRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHQQPQWLTDVQDIANKVLLALFTGEML
LKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQ
SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD
NLADAESLTSAQKEEEEAKERKKLARLASPEKRQENEKPPLEEKKSEKIELKSITSDGET
NTATKINMDDCCGDESEEKNPYPANDYIGDEDEDEPEMPVGPRPRPLSDIQLKEKAVPMP
EARAFFIFTHTNKFRVLCHQIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGY
ADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIHLDFSKSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKFFFCTDSSKQTQADCRGSYIMYKDGDVKKPEKALRLWENSDFNFDDVLQGMMALFA
VSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLIL
LNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLI
VIGSIIDVILSEINPADSSSSSSSSSPSSSSSSSSSHPPVVRQMVRPDGNLVRLPTSSTI
LPSLRPSIPPSAMASMGHQNPEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKS
FQALPYVALLIVMLFFIYAVIGMQMFGKIALRDNTQINRNNNFQTFPQAVLLLFRCATGE
AWQEIMLACSPHRPCEKGSTNENSTISEDCGSQFAIIYFVSFYMLCAFLIINLFVAVIMD
NFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHR
VACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTS
MKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRT
LHDIGPEIRRAISGDLNVEEELDKGLKEPVSAASEDDIFRRSGGLFGNHVNYYNQSDGRG
SFPQSFTTQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSGSNANINNANNTGMA
GVAAQGVSRFPSPSISTVDGQSGQPLTPILVPKSAWCFPPKRMFYDTLMRSDSSDSHLPI
IQRGEGSTEETYDESYGDDREYQEDDQSLSSDMLVYHDETCKQLAPMEEAEEVEEQKGGR
GWQSPRRVFLCPTTLGRRSSFHLECLRRHSRPDISQKTAVPLHLVHQQALAVAGLSPLLR
RSHSPTRFSWLCSTPPASPTAQCSDASYQRVPSLRLEGSNSHEKLNASLPSVNCGPWYSD
SNGNSPVPSPSPTPSVSASGQRAPRPVSLTVPSLLGKDSSSLSHGSAGSLVEAVLISEGL
GHFAQDPSFIEATKAELADACDMTIEEMEHAANNILNSNNTTTNATSSTSSASQHSPNGS
LPFHRAAAATHRDRAVGLSPGEGVAEAGGSRGYVHEPSSIEERQELLARGRGREEEEEEA
GGREERHHRSSAVIAEAQPKNSELLEDEDMECVTSL
NT seq 7131 nt   +upstreamnt  +downstreamnt
atgctgagaggcctgtttcagaggaaacttaaacatgagaggctggaggaggaacctgaa
gtcagatataagggcgtgttggtgtctgagaaagacctgggatacaaatttgtccgacct
ggaggctccgactactctcctcctccccctcttcctcgccccccacccgccggcctggcg
aatgagcacaggggcggcggtagccatggtgaccacagtggaggagggggaggggtcaac
catggcgtgggtgtggttggcctcgccccggagcacattcccacgccgggggccgccctg
agctggcaggcggccatcgatgcggcgaggcaagcgaagatgatgggcaacgcctctgca
ggtggaggggcgggacttgggtcgggagggggcgggcccatttctacagccagctccacg
caaaggaagagacagcactacactaccaaacccaagaaacaaaccacaacgacagccacg
aggccgccacgggctctactctgtctcacactcaagaaccccatccgaagggcctgcatc
agcatcgtagagtggaaaccatttgaaattatcatcctgatgaccatcttcgctaactgt
gtggccttagctgtgtacatccctttccctgaggatgattcgaatgccacaaactccaac
ctggagcgtgtggagtatctgttcctaatcatttttacagtggaggcgttcctcaaggta
atagcttatggcctgctcttccaccccaacgcctacctgaggaacggctggaatctgctt
gacttcatcatcgtagttgtagggttattcagtgcaattttggaacaggccacaaaggga
gatggggccactcctattggagggaaggcggcaggcttcgatgtcaaggcgctgagggca
ttcagagtactccgacccctcagactggtctctggagtaccgagtttacaggtagtgttg
aactccataatcaaagccatggttcctctgctccacatcgccctcctggtcctcttcgtc
atcatcatctatgccatcatcggcctggagctcttcatgggaaagatgcacaagacctgc
actcacactcacaacctttcaggtgccaacgcagaggaaaagccggctccgtgtgcgcct
gacggagcttacggccggcactgtatgcagaacggaacaaagtgccaagggggatgggag
ggtccaaacgagggcatcaccaactttgacaattttgcctttgccatgctgacagtgttc
cagtgtataaccatggaaggctggacggacgtgctgtactgggtgaatgatgcagtaggt
tacaggtggccctgggtctattttgtcaccttgatcatcatcggatccttctttgtgtta
aatttggttctcggggtgttgagcggagagttttccaaggaaagggagaaggccaaggca
cgcggtgacttccagaaacttagagaaaaacagcaactggaggaagacctcaagggctat
ttagactggatcactcaggcagaagacattgacccagagaatgaagaggagggcttagat
gatgacaaacccagaaaccgaatttctccagcccagcttactaagaagaccagaaagctt
gcttggttcagtcactctgctgactctcaggacgtgagcatgccggccagtgagaatgaa
tccgtcaacacagataacgcccccgggggagacgtggagggggagacctgctgcaccagg
ctggcaattaggatctccaaatccaagttcagccgctactctcggaggtggaacaggttg
tgtaggaggaagtgccgcgcagcagtcaagtcgcaggttttttattggctggtcatcttc
ctggttttcctcaacacgctgaccatcgcttctgaacatcaccagcagcctcagtggcta
actgatgtgcaagacattgccaataaagttttattagcactcttcaccggcgagatgctg
ctgaagatgtacagtcttggcctacaggcatattttgtgtcactcttcaatcggttcgac
agcttcgtagtatgtggggggatcctcgagacaattctagttgaaacaaagatcatgtct
cctcttggcatctctgtgttacgttgtgtacgcttgctcagaatcttcaaaataaccaga
tactggaactctctttccaacctcgtggcttcactgctgaactcagttcgctctatcgcc
tccctgctgctcctgctcttcctcttcatcatcatcttctctctgctgggcatgcagctc
tttggggggaagttcaacttcgatgagaccaggcggagcacctttgacaactttccccag
tccctgctcactgtgttccagattttaacaggagaggactggaactctgttatgtatgat
ggtatcatggcctacggtggtccatcttttcctggcatgctggtctgcatctattttatc
atcctcttcatctgcggaaactacatcctgctgaatgtcttcttggccatcgctgtagac
aatctggctgacgccgagagtctcacatcggcccagaaagaagaggaggaggcaaaggag
aggaaaaaactagccaggctcgccagtccagaaaagcgccaagagaatgagaagccgcct
ttggaggaaaagaagagcgagaagatagagctgaagtccatcacctctgatggggagacc
aacacggcaactaagatcaacatggatgactgctgtggagatgaaagtgaagagaagaat
ccttatcctgcaaatgattacataggagatgaggatgaggatgaacccgagatgcctgtg
gggccgaggccgcggccgctctctgacattcagctcaaagagaaggctgttcccatgcct
gaggctcgtgcgttcttcatcttcacccacaccaacaaattcagggttctgtgccaccag
atcgtcaaccacaacatcttcaccaacctcatcctcttcttcatcctgctcagcagcatc
agtctggcagcagaggatccagtcaagaacgactccttcagaaatcagatcctgggctat
gcagatcatgtcttcaccggactcttcaccatagagatcattttaaagatgacagcgtat
ggagccttcctccataaaggctcattctgcagaaattatttcaacatcctggacttagtg
gtagtcagcgtgtccctcatctcctctggaatccacctagacttctcgaagtccagtgcg
attaatgtggtaaagatcctgagagtcctgcgagtgctcagaccactgagagccatcaac
agagctaaaggactaaagcacgtggtgcagtgtgtgtttgtggccatcaggaccatcggc
aacattgtcatcgtcaccacgttgctccagttcatgttcgcctgtataggagtgcaactc
tttaagggcaagttcttcttctgtacggacagctctaagcagactcaggcggactgcagg
ggttcttacatcatgtataaggacggcgatgtgaagaagcctgaaaaagccctgagactc
tgggagaacagtgatttcaactttgacgacgtcctgcagggaatgatggccctgtttgct
gtgtctacttttgagggctggccagggttactgtaccgagccatcgactcccatgccgag
gacgtcggccccatctacaattaccgcgtggtcatctccatcttcttcatcatctacatc
atcatcattgccttcttcatgatgaacatattcgtcggtttcgtcatcgtgacattccag
gagcaaggagagcaagagtataagaactgtgagctggacaagaaccagcgtcagtgtgtg
gagtacgccctgaaggctcgtcctctgcgtcgttacatccccaagaacccgtaccagtac
aaggtgtggtacgtggtcaactccacctactttgagtacctgatgttcacactcatcctg
ctcaacaccatctgcctggctatgcagcatcatgggcagaccaaaaactttaacgatgca
atgaacatcctcaacatgctcttcaccggactgttcacagtggagatgatccttaaactg
atcgccttcaaacccagggggtactttagtgatccctggaatgtgtttgatttcctcatc
gtaattggcagcattatagacgtcattctcagtgagatcaacccagctgactcctcctcg
tcctcgtcctcctcctctccgtcctcctcttcctcctcttcctcctctcacccccctgtg
gtaaggcaaatggtacgccctgacggtaacctcgtccgcctccccacctcctccaccatc
cttccatcccttcgtccttccattcctccttctgctatggcctccatgggacatcagaac
cctgaagagaatgccaggatctccatcaccttctttcggctgttccgtgtgatgaggctg
gtgaagctgctgtcccgtggggaagggattcggacgctgctgtggaccttcataaaatcc
ttccaggctctgccctacgtagctctgcttatagtgatgctcttcttcatatacgctgtc
atcggcatgcagatgtttggtaagatagcgctgcgggacaacacgcaaatcaacaggaac
aacaatttccagacattccctcaggcggtgctgctgctcttcagatgtgcaacaggcgag
gcgtggcaggagatcatgctggcatgttcaccccatcggccgtgcgagaagggctcgacc
aatgaaaacagcaccattagcgaggactgtggcagccagtttgccatcatttactttgtc
agcttctacatgctttgtgcctttctgatcatcaatctgtttgtggctgtcatcatggac
aattttgactacctgacgcgtgattggtcaattctgggaccacatcaccttgacgagttc
aagagaatctgggctgaatatgacccagaagcaaaggggaggataaaacaccttgatgtg
gtcactcttctgcggagaatccagcctcctctcggcttcggaaagctctgtccacacagg
gtggcatgcaagcggctggtgtcgatgaacatgcctctgaacagcgatggaaccgtgatg
tttaacgccacactgtttgctttggtcagaacagcactcaggatcaagacagaaggtaat
ctggagcaggcaaatgaagaactgagggcaattgtgaaaaagatctggaaaagaaccagc
atgaagctcttggatcaagtagtgccccctgctggagatgatgaggtaacagtcggaaag
ttttacgccaccttcctcatccaggagtattttcgcaagtttaagaagaggaaagaacaa
ggactggtggccaaggtgccccccaaaactgccctctctctgcaggcgggcctgcggacg
ttgcatgacatcggtccagagattaggagggcgatctctggggacttgaacgtggaggag
gagctggacaaaggtctgaaggagcctgtgtcagcagcatccgaggacgatatcttcagg
cgttctggcggcctgttcggcaaccatgtcaactactacaaccagagtgacggccgaggg
tccttcccgcagtccttcaccacccagcgtcctttgcacatcagccaaaagggctccccg
tgcgaaggcgagagcccgtctcatgagaagctaatggactcaaccaccttcaccccttcc
tcttactcgtcatcaggctcaaacgccaacattaacaatgccaacaacactggcatggcg
ggagtggcagcccagggcgtcagccgattcccgagcccgtctataagcactgtggacggg
caaagcgggcagccactcacccccatcctggtgccaaaatctgcatggtgcttccctcca
aagaggatgttttatgacaccctcatgcgctcggactcgagtgacagtcatctgccaatc
atccagagaggggaggggtccacagaggagacgtacgatgagagttatggtgacgacagg
gagtaccaagaagatgaccagtcactttcttctgacatgttggtgtatcatgatgaaaca
tgcaaacagctggctcccatggaggaagcagaagaagtagaggagcaaaaaggaggacga
ggatggcagtctccgcgaagagtcttcctctgccctacaactctgggtcggagatcgtcc
ttccatctggagtgtctcagaagacactcgagaccagacatctctcagaagacagctgta
cccttacatcttgtacatcaacaggctctggcagtagcagggttaagtcctctgctgaga
aggagtcactcacctactcgcttcagctggctgtgctccacacctccagccagccccaca
gctcaatgtagtgatgcctcctaccagcgagttccctctctgaggctagagggctctaac
tctcatgaaaagctcaatgccagcttgccttctgtcaactgtgggccctggtacagcgac
agtaatgggaacagcccagtacccagccctagccctacgccgagcgtgtcagcgtccggt
caaagagcaccgaggccggtgtcattaacagtgccctcgcttttggggaaagactccagt
tcgctgtctcacggcagcgcaggcagtctagtggaagcggttctaatatcagaaggtttg
ggccattttgcccaggacccatcgttcatcgaggcaaccaaagccgagttggctgatgcc
tgtgacatgaccattgaggagatggagcacgcagccaacaacattctcaatagcaacaac
acaaccacaaacgccacatccagcacctcttccgcctctcagcacagccctaacggcagc
ctccccttccatagagcagcagcagcaacacacagggaccgagctgtcggcctaagcccc
ggagaaggcgtggcagaggccggaggaagcaggggctacgtccacgagccgtcctctata
gaggagcggcaggagctgctagcccgggggagagggcgagaagaggaggaggaagaggca
ggagggagggaagagaggcatcacagaagttcagctgtgattgcagaagcgcaaccgaag
aacagcgagcttttagaggatgaggatatggagtgtgtgacaagcttgtag

DBGET integrated database retrieval system