KEGG   Kryptolebias marmoratus (mangrove rivulus): 108235550Help
Entry
108235550         CDS       T05608                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: epsin-1-like
  KO
K12471  epsin
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108235550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108235550
Membrane trafficking [BR:kmr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108235550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH VHS UIM
Motif
Other DBs
NCBI-GeneID: 108235550
NCBI-ProteinID: XP_017271127
LinkDB All DBs
Position
Unknown
AA seq 665 aa AA seqDB search
MSTSSLRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMV
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQG
LNVREKAKQLVTLLKDEEKLREERIHALKTKEKMAQTTSASSAPSAPSLGGSLSLGSHSL
GADPDQAWPQSSGEEDLQLQLALAMSKEEAEQYTSLCSHHLTTDLPQNSADPLEVAELRY
AITLSQEMHQKEERLRRGDDLRLQMAIEESKREKPKPEEGALMELSAADPWGAPATVTVS
SAGPSPPLTVSGPASSSGPWGTAPADPWGVASPTSPTSSDPWGGGAPPTIAPPPDPWGET
SNKVNNVDPWGNSAVTPPSADPWGSPVPPSTSSSGGPVDPWAGEGSVPASDPVSSDIWSG
TAKHTNGTGDPERRGSSAAVGDSTSSPVPFDLSSLGSSLPVRKTPESFLGPNAALVDLDS
LVSSKPKPKPKQQPPPSISSSSTNNPFLQNTGSSPAPGMAVTPGSTISSRGVSPTPASSN
PFGVAPAMSSISPQPSSLGLSALRTSPVPPNPMLGMVQPGMGLGPMSVGMGAPGMGLGMM
QASPMGMPFSGLSPMGPPGSALLGPGGMPPPQQILGGPAGAGXMGAGGSMGGGATAGTST
NPFLL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcatcgctacggcgacaagtaaagaacatcgtccacaactattcagaggca
gaaatcaaggttagagaggcaacgtccaacgacccatggggtcccagcagctctcttatg
tcagagatcgcagatctgacctacaacgtcgtggccttctcggaaatcatgagcatggtg
tggaagcgactcaatgaccacggaaagaactggagacacgtgtacaaggcgatgactctt
atggaatacctgatcaagacgggttcagaacgtgttgcccaacagtgtcgagaaaacatc
tacgcagtccaaaccctgaaggatttccagtacatagacagagacggcaaagaccagggt
ttgaatgttcgagagaaagctaagcagcttgtgacgttgttgaaagacgaagaaaagctc
agagaggagaggatccatgctctgaaaaccaaagagaaaatggcacagaccaccagcgcc
tcctcagccccctcggcgcccagcctggggggcagcctatcactgggctcgcactcttta
ggggccgatccggatcaggcgtggccgcaaagctccggagaggaagacctgcagctgcag
ctggctttggccatgagtaaagaagaggccgagcagtacacctcgctctgctctcaccat
ttaaccactgacctcccccagaatagcgcggatcctctggaggttgcagagctgcgctat
gcaatcacgctcagccaagagatgcaccaaaaggaggagcggctgcgcagaggtgacgat
ctgagactgcagatggccatcgaggagagcaaaagggagaaacccaaaccagaggagggt
gcgctgatggagctgagtgccgcggacccctggggggcccctgccaccgtcactgtgagc
tccgccggcccttcacctccactcacagtttccggccccgcctcttcctccgggccgtgg
ggtacggcgcccgcagacccgtggggggtggcgtcacccacctccccaacgagctccgac
ccctggggagggggagcgccgcccactatagcccctccccccgacccctggggtgagact
tccaacaaagtcaacaacgtggacccctggggaaactcagctgtgaccccccccagtgct
gacccctggggctccccagtgccacccagcacatcctcctcggggggaccggtagacccc
tgggcgggggaggggtccgtccctgcctctgaccctgtctcctccgacatctggagtggc
accgccaaacatactaacggcacaggagatccagagaggcgagggtcttcagcggcagtc
ggcgacagcacgagctcgccggttcccttcgacctgtcgtctctcggctcctcgctgccc
gttcggaaaacgcccgagtccttcctcggccccaacgcggcgcttgtcgacctcgactcc
ctggtgtcgtccaaacccaaacccaaacccaagcagcagccgcctccttccatctcttcg
tcttcgacaaacaaccccttcctccagaacacaggctcgtctcctgctcccggcatggcc
gtaactccaggcagcaccatttccagcaggggcgtttctccgacaccggcctcctccaac
cccttcggcgtggcccccgccatgagctccatctccccccagccctcgtctttaggcctg
agcgccctgcgcaccagccccgtgcctcccaaccccatgctgggcatggtccagccagga
atgggcctggggccgatgagcgtggggatgggggcccccggaatgggcctgggcatgatg
caggccagccccatggggatgcccttcagcggcctctcccctatgggacccccaggctct
gctcttttgggaccaggaggcatgccaccccctcagcagattttgggtgggcccgccgga
gcagggnngatgggggcgggggggtcgatggggggcggggccacggcgggcacgagcacc
aacccgtttcttctttga

DBGET integrated database retrieval system