KEGG   Kryptolebias marmoratus (mangrove rivulus): 108237275Help
Entry
108237275         CDS       T05608                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kmr01002]
    108237275 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmr04147]
    108237275 (ace)
   04090 CD molecules [BR:kmr04090]
    108237275 (ace)
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     108237275 (ace)
Peptidases [BR:kmr01002]
 Metallo Peptidases
  Family M2
   108237275 (ace)
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108237275 (ace)
CD molecules [BR:kmr04090]
 Proteins
  108237275 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 108237275
NCBI-ProteinID: XP_017274094
LinkDB All DBs
Position
Unknown
AA seq 1288 aa AA seqDB search
MGTFVDRLVRSLLLLLPVLVLCEALPESWLPGDYTNSTSDALRFLRDYNSTAEDVFFYSA
SASWNYNTNLTEHNSKLQVKAALEEQAFAEAWGFKAKNVFSESLLNSLPNPEDKKLIENV
KVLGPANLPQAEREEFNTILSTMDSIYSTAKVHPQPNISWSLEPEITEIMASSRSYKQLL
FAWEGWHNASGVPLKRHYPRFVELSNKASQADDFEDTGAYWRSWYESDTFEQDLEKLYRT
IEPLYLNLHAFVRRKLYNFYGPKYINLKGPIPAHLLGNMWAQTWNNIYDMMIPFPDKPNL
DVTGEMVKQGYNATHMFRVAEEFFTSLGLAEMPTEFWEGSMLVKPDDREVVCHASAWDFY
NRKDFRIKQCTTVTMEQLATVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVMSLS
VTTPNHLHKINLLESVASDAETDLNYLLKMALEKIAFLPFGYLIDRWRWGVFSGSTPPEK
YNSEWWYLRTKYQGICPPTRRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCQA
AKHTGPLHTCDIYQSVEAGAILKKVLQAGSSKPWPDVLQEAIGTREMSATSLMKYFEPVI
EWLKKQNVNETLGWPEFNWVPPIPEGYPDDIDKNTDELDAKKLLEDYNSTAEVVWNAYTE
ASWAYNTNINEANKETMLEKNLDMSKHTLEYGLKARKYDISDFQDPSVKRVIEKLSDIER
AALPSAELEEYNTLISNMETKYSVAEVCRSKEKCYPLDPDLQKIMAESRDYDELLFAWKG
WRDAAGKVLRQDYKRYVELANKAATLNGHSDNGAFWRSLYETPTFEEDLETLWKELEPLY
LNVHAYVRRALYKKYGSKYINLKGPIPAHLLGNMWAQTWSGIMDLVIPYPDATQVDATPA
MVAQGWNATRMFQESDRFFTSLGLLPMPKEFWDKSMLEKPSDGRQVVCHASAWDFYNRKD
FRIKQCTVVTMDDLVTVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTP
KHLQSIGLLDKVETNHESDINFLMSMALDKIAFLPFGFLMDQWRWKVFDGRIPSTEYNKE
WWNLRLKYQGLCPPVTRTEYDFDPGAKFHIPANVPYVRYFVSFVIQFQFHKALCDAAKHV
GPLHTCDIYKSQEAGKLLGDVMKLGSSKPWPEAMAMITGQSKMSAQPLMQYFKPLIDWLE
AENNKNKDVRGWPEYNWKPDTRSTEDIKTNKVDFLGMSVEDSSAIAGQWILLVIGLVLLV
ATILLAYKYRKSKKSEWSSSAVELHQKD
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgggtacattcgtggacaggttagtcaggtcccttctgctgctgctgccagtcttggtg
ctgtgtgaagctctgccagagagctggctgccaggggactacacaaacagcacctctgat
gcgctcaggttcctccgcgactacaacagcactgctgaggacgtgttcttctacagcgcg
tctgccagctggaactacaacaccaacctaacagaacacaactccaagcttcaggtcaaa
gcagcccttgaagaacaagccttcgctgaagcctgggggttcaaggccaagaatgtcttt
tctgagtcacttctcaactctctcccaaaccccgaagacaagaagctgatagaaaatgtc
aaggtgctgggtcctgccaaccttccacaggctgaaagagaagagttcaacaccatcctc
agcaccatggacagtatttattccacagctaaggtacaccctcagccaaatatcagctgg
agcctagaaccagaaatcacagaaatcatggccagttccagaagctacaagcagttgctg
tttgcttgggaaggctggcacaatgcatcaggtgtgcctctgaaacggcattatcccagg
tttgtggagctcagcaacaaagcatcacaagctgatgactttgaagacactggagcttat
tggcgctcttggtatgaaagtgacacttttgagcaggatctggaaaaactctacaggacc
atcgagccactctacttgaacctgcatgcttttgtgcgccgcaagctctacaatttctac
ggccccaagtacatcaatcttaaaggaccgatccctgcccacctgttgggaaatatgtgg
gcccagacttggaacaacatttatgacatgatgatcccatttcctgataaacccaacctg
gatgtgactggtgaaatggtcaaacaaggctataatgccactcacatgttccgtgtggct
gaggagttcttcacatctttaggtttagcagagatgcccacagagttctgggaaggctca
atgcttgttaagcctgatgaccgagaagttgtgtgtcatgcatctgcttgggacttttac
aaccgcaaagatttcaggattaaacagtgcaccacagtgacgatggaacagctcgccacg
gttcatcatgaaatggggcacatccagtattacctgcagtacaaggaccaacctgtgggc
ttccgccgtggagccaaccctggtttccatgaagctattggtgacgtcatgtctctttca
gttacgacaccaaaccatctgcacaaaatcaacctgctggagtctgtggcctccgatgct
gaaactgatctcaattacttattgaagatggctctggaaaagatagccttccttcctttt
ggctaccttattgaccgctggagatggggtgtgtttagtggaagcacccctccagagaag
tacaactctgagtggtggtacctcaggacaaaataccaaggaatttgcccacccaccaga
cgtacagaagagcattttgatcctggtgcaaaataccatatccctggaaatacaccatac
atcaggtattttgtcagcttcatcctgcaattccagtttcatgagaaactgtgccaggct
gccaaacacacaggccccctgcacacatgtgatatctaccaatctgtagaagcaggagcc
attctgaagaaagttctacaggctggctcttccaaaccttggcctgatgtgcttcaggag
gctataggcaccagggagatgagtgccacctcactgatgaaatactttgagcctgtaatt
gaatggctgaagaaacaaaatgtgaatgagaccttgggatggcctgaattcaattgggtt
ccacccattcctgagggctaccctgatgatatcgacaagaatacagatgagcttgatgca
aagaaacttctggaagactataacagcacagctgaggtggtgtggaatgcgtacactgaa
gcctcctgggcatacaacactaacatcaatgaagctaataaagagaccatgcttgagaag
aacctggacatgtcgaagcacaccctggaatatggactgaaggctcgcaagtatgatatc
tctgacttccaggatccctcagtgaaacgtgtcattgaaaaactcagcgacatcgagagg
gctgcactgccctcagcagagcttgaagagtataacactctaatatcaaacatggagacc
aagtacagcgtggctgaggtttgcagatccaaggagaaatgctatccgttggatccagat
ctccagaagatcatggcagagtctagggattacgatgaactgctatttgcctggaaagga
tggagagatgctgctggcaaagtactccgtcaggattacaagagatatgttgaactggcc
aacaaagctgctacactcaatggtcattctgataatggagctttttggcggtctctgtat
gaaacccccacctttgaggaggacctggagactctgtggaaggagctggagccgctctat
ctgaacgtacatgcatacgttcgaagggctctgtacaaaaagtatggctccaagtacatc
aacctaaaggggcccattcctgctcatctgctgggcaacatgtgggctcagacctggtct
gggataatggatctagtcataccctacccagatgccacgcaggttgatgctacaccagct
atggtggctcagggctggaatgctaccaggatgtttcaggagtcggatagatttttcacc
tctctgggtcttctgccaatgcccaaagaattttgggacaaatctatgcttgagaagcca
agtgacggacggcaggtggtgtgccatgcttctgcgtgggacttctataaccgaaaagac
ttcaggataaaacagtgcacagttgtgaccatggatgacctggtcacagtgcaccatgag
atgggccacgttcagtacttcctgcagtacaaagatcagccggtgtcgttccgtgatgga
gccaacccaggcttccacgaggccatcggagacgttctcgccctgtctgtctccacaccc
aaacacctgcaaagcattggcctcctggacaaagttgagaccaaccatgaaagcgatatc
aactttttgatgagcatggcacttgacaagattgctttcctgccttttggcttcctgatg
gatcagtggaggtggaaggtttttgatgggcgtatcccatcaacagagtacaataaagaa
tggtggaacttgagattgaagtaccagggcctgtgtcctccagtaacacgcactgagtac
gactttgacccaggtgcaaagttccacatccccgcaaacgtgccctacgtcaggtatttt
gttagctttgtcattcagtttcagttccacaaggctctttgtgatgctgctaagcatgtt
gggcctctgcacacatgtgacatctacaaatctcaagaagccggaaagctgctgggcgat
gtgatgaagctgggtagcagtaagccttggcctgaagccatggccatgatcaccggtcag
tccaaaatgagtgcccagcctctcatgcagtatttcaaacctctcattgactggctggag
gcagagaacaacaagaacaaagatgttcgtggatggcccgagtacaactggaaacctgac
acacgttctacagaagacattaagacgaacaaagtggacttcctgggaatgagtgtagaa
gattcatccgccatagctggccagtggatcctgttggtcattggtctggtcctcttggtg
gccaccatcctacttgcctacaagtacaggaagtcaaaaaagtctgagtggtcctcatcc
gcagtggaacttcaccaaaaagactag

DBGET integrated database retrieval system