KEGG   Kryptolebias marmoratus (mangrove rivulus): 108237661Help
Entry
108237661         CDS       T05608                                 

Definition
(RefSeq) F-actin-monooxygenase mical1-like
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108237661
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     108237661
Membrane trafficking [BR:kmr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    108237661
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    108237661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM FAD_binding_3 Pyr_redox_3 Pyr_redox_2 FAD_binding_2 HI0933_like CH_2 NAD_binding_8 AlaDh_PNT_C Pyr_redox NAD_binding_7 DAO Phospholip_A2_3
Motif
Other DBs
NCBI-GeneID: 108237661
NCBI-ProteinID: XP_017274751
UniProt: A0A3Q3ELS7
LinkDB All DBs
Position
Unknown
AA seq 1246 aa AA seqDB search
MASPDPGNPSHATFDLFVQAKTCPEVKLRFTELCRQLHIDPTDFRSFYTKLKEKLNYWKA
KALWTKLDKRVSQAVYQQGKVCSKNKCLVLGAGPCGLRTAIELSLLGAQVVVLEKREEFT
RNNVLHLWPFTIYDLRELGAKKFYGKFCSGSLDHISIRQLQLILLKVSLLLGVEVHTEVE
FQGLIEPTSETGWMAKLQPPSHPAATYQFDVFISAGGGRFVPDGFKHKEMRGKLAIGITA
NFINGNTTAEAQVAEISGVARIYNQKFFQNLLNQTDIDLENIVYYKDDTHYFVMTAKKKS
LLKKGVIKQDYSDAEQLLAPANVDHVALCLYAHDAAYFSTAGKLPDLQFAQNHAGQSDVA
MFDFTCMHRAENASLVRERRGRKLLIALVGDCLVEPFWPLGTGIARGFFAAFDTAWIVRS
WGMGVPHPKVLAERESIYQLLSQTTPENTSKNYSQYSIDPKTRYQRINLSSIQAHQVQHL
YDADKTRPSSTKQKDSQCVMRRDSASGFEELLKWCQKHTTGYKNVNVKDFTQSWRSGLAL
CALIHHFRPQLIDMSSLDESNGIHNNQLAFSIVQKELGIPPVMSPSGQIDKLSMVLYLTQ
IKDSFALPPKEPLKTHKTLNFSRTQSAVFFLSKLKHHSLQRRQEKLAAEKQATKIERRMG
DEDHTLVPSVPPEVHPPPPPASMPEPDEAELMPNSEQCYFCGQMVYVVERISAEGKFFHR
SCFTCHQCSITLRLGGYTFDKNTGRFYCELHSEELLLQNGVETSCEEGKENHTDTDEENG
PSSEEDTPSPSDDEYYFTSAATQHIAETEKESQEPQKSKASSDPASKTDVTVSSKEETEE
TIVCPAPKPRFSRQRTPSLEPSAPVAKPRTIMINVGNSSSPVLAMKVSKPEVDSRPKQSL
RKLQLSVEEKSELGNLQSFSADSDSETPGGSSSCSSSSANAGGAPKQDGLDGQEEEGYWS
GSTASLNRDQRNRHCFRKKEMPSGQSKVRSKFSPWNLSSPRINRDTRLSVHVSHPGRVET
TFRHVHSASEDGVDEDEDDDEDDLMLESEDLDSFDKKFQTVPSDPVEAAKLELKKMRTLE
RRAKMSEIQRFRKAQSIQRRLEEIEVSYKELEDKGVVLERCLRGESSNSGTPDTIEQWIQ
LVHEKNALVSEESDLMVASRQLELEDKHSTLELEYRKYMELKEKTPEQQAEEDEIFQQII
EVVEMRDSLVTFLDEKRLKEISEKEEAFSIMEAKRHSKTGSQVQWA
NT seq 3741 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccggatcctgggaatccttcacatgctacgtttgacctttttgtccaagcg
aagacatgtccagaagtgaaactgcgctttaccgagctctgccggcaactgcacatagat
cctacagattttaggagcttctatacaaaacttaaagaaaaactgaactactggaaggcc
aaagctctatggaccaagttggacaagagagtgtctcaagcagtttaccagcaaggaaaa
gtctgctccaaaaacaagtgtttagtgttgggtgctggaccatgtgggctgaggacggcc
atcgaactgtccctgttaggggctcaggtggtggtgctggagaagagagaggagttcacc
aggaacaatgttctccacctgtggcccttcaccatctacgacctccgagagctcggagcc
aaaaagttctatggcaaattctgctctggctctctggatcacatcagcatccgtcagctg
cagttaattctgctgaaggtctctcttctcctcggggtggaggtgcacactgaagtggag
ttccagggtttgattgagcccactagtgaaactggttggatggccaaactgcagcctcca
tctcatcctgctgcaacctaccagtttgacgtcttcatctctgctgggggaggcaggttt
gtccctgatggttttaagcacaaggagatgagaggaaagctggccattggcatcaccgcc
aacttcatcaacggcaacaccactgctgaggcgcaagtagcagagatcagtggtgtagcc
cgcatctataaccagaagttcttccaaaatctgctcaaccaaacagatattgatttggag
aatattgtctactacaaagacgacacccactactttgtcatgactgccaagaagaagagc
ttgctgaagaagggggtcattaaacaggactacagcgatgcagaacagctgctggctcct
gcaaatgtggatcatgtggctttatgcctttatgctcacgacgctgcatacttctccacc
gctggcaaactgcctgacctccagtttgcccaaaatcatgcaggccagtcagatgtggcc
atgtttgacttcacctgcatgcaccgcgctgagaatgcctctctggtccgggagagaagg
ggcaggaagctgttaatagctcttgttggagactgtctggtggagcccttctggcctctg
gggacaggcatagctcgtggattctttgctgcctttgacacagcgtggatcgtgaggagc
tggggtatgggtgtcccacatcctaaggtcctagctgagagagaaagtatttaccagctc
ctctcccagaccacacctgaaaacaccagcaagaactactctcagtacagcatcgaccct
aaaacacgataccagagaatcaacctatcctccattcaggctcaccaggttcagcacctt
tatgatgctgataaaacccgaccatcgagcacaaaacagaaggacagtcagtgcgtcatg
cgtcgagattcagccagtggttttgaggagttgttgaaatggtgccagaaacacaccaca
ggttataagaatgtcaatgttaaagatttcacccaatcctggaggtccgggctggctctg
tgtgctctcatccaccactttagaccccagctgattgacatgtcttccctggatgagtca
aacggcattcacaataaccagctcgccttcagcatcgtacagaaagaactgggcatcccc
cctgtcatgtctcccagtggacagatagataagttgtccatggtcctctaccttacccag
atcaaagactcttttgctttgccaccaaaagaacctctgaaaacacacaagaccctgaat
ttctccagaacacagtcagctgtctttttcctgagcaagctaaagcaccactctctgcaa
agacgccaggaaaagttggcagctgagaaacaagccacaaaaatagagagaagaatggga
gatgaggatcatactttggttccatctgtgccccctgaagtccatcctccacctccacct
gcttccatgcctgaaccagatgaggctgagttgatgccaaacagcgaacagtgttacttc
tgtggtcaaatggtgtatgtggtggagcgcatcagtgctgaaggaaagttcttccatcgg
agctgttttacctgtcatcagtgcagcatcacactccgactcggaggctacacctttgac
aagaatacagggaggttttactgtgagctgcactctgaagaactgttgcttcaaaatgga
gtggaaacatcttgtgaggagggcaaagaaaatcacacagacacagatgaagagaacggg
ccttctagtgaagaggatacaccatctccatcggatgatgagtattacttcacttctgct
gcaactcagcatatagctgaaactgaaaaagagtcccaagagccacaaaagtctaaagcc
tcatcagaccctgcatctaaaactgatgtaactgtgtccagtaaggaggagacggaggag
acaatcgtttgtccagccccaaagccacgcttttctcgtcagagaacgcccagccttgag
ccctctgccccagttgcgaaacctagaacaatcatgataaatgtagggaactcttcatct
ccagttcttgcaatgaaggtctctaaaccagaagtagactcgcgtcctaaacagtccctc
cgaaagcttcagttgagcgtagaggagaaaagcgagctgggaaatcttcaaagtttcagt
gcagactcggactctgagacccccggtggatcctcctcctgctcctcttcctctgcaaat
gcaggaggagccccaaaacaagacggcctggatgggcaagaagaggagggctactggagt
gggagcactgctagtcttaaccgagaccaaaggaatcgacactgcttcaggaaaaaagag
atgccaagcgggcagagcaaagtgcgatcaaagttttccccctggaacctctcgtctccg
aggatcaacagagacacccggctcagtgtccacgtcagtcatccagggagagtggaaaca
acattcagacatgtccacagtgcctcagaggatggtgttgatgaggatgaagatgatgat
gaggatgacttgatgttggaatctgaggatttagattcatttgataagaagtttcaaact
gtaccatcagacccagttgaggctgccaagcttgagttaaagaagatgaggacgctggag
cggcgagccaagatgagtgaaatacagcgattccgtaaagctcaatcaatccaaagaaga
ctggaggagattgaggtgtcgtataaagagctggaggacaaaggtgtggtgttagagaga
tgtctgcgaggagaatctagcaacagtggcacccctgatacgattgaacagtggatccag
ttggtacacgagaagaacgcgttggtttccgaggaatcagaccttatggtggcgtcccga
cagctggaacttgaagacaagcacagcaccttagagctggagtacaggaagtacatggag
ctgaaagaaaagacccccgagcagcaggcagaagaggatgagatttttcagcagataatc
gaggtggtggaaatgagggactccctggtgacatttttggatgagaagaggctgaaagag
atcagcgagaaggaagaggctttttccatcatggaggccaaaagacactcaaagacagga
tctcaggttcagtgggcctaa

DBGET integrated database retrieval system