KEGG   Kryptolebias marmoratus (mangrove rivulus): 108237783Help
Entry
108237783         CDS       T05608                                 

Definition
(RefSeq) uncharacterized protein LOC108237783
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00310  Lysine degradation
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108237783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kmr03036]
    108237783
Enzymes [BR:kmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     108237783
Chromosome and associated proteins [BR:kmr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108237783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 108237783
NCBI-ProteinID: XP_017274956
UniProt: A0A3Q3A775
LinkDB All DBs
Position
Unknown
AA seq 1905 aa AA seqDB search
MDGYTRMSVKELCETDDLATSLVLDPLMGFSTHKMNISPPPEVRRWGNLKETLLRFQRTH
DFDATFEALTVGELAGDYFNALGSHRQELLRQHVYRYLGAFLLDSGIKIESCDRYSSETN
GAKITSTRHWFVGERVEVLLGCIAELSPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFVPGEKNIACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFKHRGKQPECEETKDPVGQKYRLRERYLRHHREKGHLTARPPGMHSGIFKAIPSRNSF
TQQMRRNALKNRKLSETKKWRREKQRRTGKLPLKASAVKQCRTVPPLSHVALRDVRIRVR
RHTVDFLLSCKDPNSKERALLQQLEERRQEKSAGEENLKPFTLNSSMSGNQKPRPAARSA
GFDKKPIRAANRPAARTRTSSKTQGAARTAQQAESEPDNTDSAGTTTVCQPVQDDRTCAA
TTQEETDETITEGQSNSCSGVQPCGAAEAQNPGAGGSETAVDNPVKSLKQYVTVNLTRLS
VRQSLEAEKLRGAGSVAARGRSKPKPAIKQGSRSDTCPAEGKTAAGQVNLRKRQRGEAVE
ESSQAEEKRADTVVEVQVLSGEQEDKQKEQQDVLQVSEGQKENSASNAVECENTRVEKEV
KVSREGRRGQKKQAVCKRRGAPKESGQMRRSLSDEPASRKEDVVIKQAKVLLSDVLRKDK
SLIKKKPQGNVGTELCSAPSKQPEQTEMNGNRCRGRMMRRRKMLRRTWKTKAEKKQGADG
HSSDGIPASAKMDASKKSCPFQPEQRRNETPTTCLNTLPHRAQVSAKANPQLHTQSNIPL
KKRTFRSSVDMDSEQSVNSVSGQLLKKTPELSSHAAPKHNSAPCLGENHLKRDNKGKTVS
KRTTKQPSSSRTLRPRGNEAQRGHLLRKVKKCSSQRQDEDIRDQTAQSDELAEDKDAEGK
LKSLSLPELSAKDQLQTNCLEPSDSEETKPAFDLKFRLKRRRGKVWEMQTEGVVLKSEKK
EDLMACDPFKAIMDSVSILNMEMEAHVQASKKSKSRSDRFKQRHERFGKNSESLCGPSEF
TGGKVEVKEKFDRIQQVSEKSESQNSEGVSAVQEPKTEDRFLNNCCLFESGLQQKLEPEL
GANGLSLPIIKLRRKTEDIWEVDSKKGLLQPDLITEPKIKRETKISCRTKGFSDLGTLKD
ENPSYQRLHSNQAPSKTDLPPFSLSLSPLSLSSPLNENKAEGADRLTERSKMMEEERKQR
HRVDRSRRCGPVETPTTCLSHTLQQIDNSLSRLSEGLCSSQTLEKPPACSGTSNSVIQTP
SESPLFAAADNMLSGEPSFTNCCDDILDFQCLSFEPQNILPSSPSDLCSLDPPTDPFSSP
LSHSPSDTWTTETPYLGPPSPQNNFTSEDLQFFPGLISSKNDSVPFECGAKDASKDKHPP
NPACGFSALGNSDLMAKDRSRNSGMRFSKESAAVASKPRFYGGSSSSVATQSPVSFTQTS
ANIKPSSCQSKSHLSLKTQGPFHRMTIPTKSPTFPSNPGRGVSSQTSNRFPSPQLFSVKN
PNPPESSFNFQEKPSTVIHRVLKFQGGNQTQNLYSAPCKDAAAVGGLTVPPRRSGDPEKT
PKFGVYTERSHKSNTSVHLSQLGPPTNPSRPNLHFTKPNSSTSQSFGKNKMMSDKQEGGE
PNAAYKNFSELPRPFFFPSKGSDCYLSPQDKSLKLDKAAASSSDKHQLCYTQQDAYDFSY
SSPLSPMSQHSSTPPATPAHANKSQPPSSASFPYGYQGPPYVLNFSGDHSLTLGLRDGTE
GYPGLGSTNYTYHCLMEPSGTQGRLVLEPCGPQLANPSSLGGFAGLKGQDEHCRKDMQQQ
CPPGEHQGAPHYGPVTSHSMGATKPKRVRLVVTDGTVDLDLQYSD
NT seq 5718 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtacactagaatgagtgtgaaggagctgtgtgagaccgatgacctggccacc
agtttggtgctggaccctcttatgggcttcagcacccataaaatgaacatcagcccccca
ccggaggtccggcgttggggcaacctgaaggagaccctgttgcggtttcagcgcactcac
gacttcgatgccacgttcgaggcgctgacggtcggggagctggcgggcgactacttcaac
gctctgggaagccatcgacaggagctgctgagacaacacgtttatcgttacctcggcgcc
ttcctgctggacagtggcatcaagatcgagtcctgcgacagatactcgtcagagacgaac
ggagcaaagatcacatcaacgaggcactggtttgttggcgaacgcgtggaggtcttactg
ggctgcatcgcggagctgagccccgcggacagcgccgtgctgagggcgggggtcaacgac
ttcagcgtgatgtattccacccgtaaacgctgcgcccagctctggctcggacccgcagct
ttcatcaaccacgactgcaaaccgaactgcaagtttgtccccggtgagaaaaatatcgcc
tgcgtggaagtgattcgacccatatcacctggggaagagatcacgtgttactatggagcc
agtttttttggcgaaggcaacgaaatgtgtgaatgctgcacctgcgagaggaacggggag
ggacacttcaagcatagagggaagcagcctgaatgtgaggaaacaaaagaccccgtgggc
caaaagtaccgcctgagagagcgatatcttcgtcatcacagagagaaaggtcatctcact
gcgagaccaccaggaatgcactctgggatttttaaagccatcccttcaaggaactccttc
acccagcagatgaggagaaacgccttgaagaacagaaaactgagcgaaaccaagaagtgg
cggcgagagaagcagagacggacaggaaagcttccgctgaaagcctccgcggtgaagcag
tgcaggacggttccgcctctgtcccatgtcgctctgagggacgttcggatccgggtccga
cgccacaccgtggacttcctgctcagctgtaaggaccccaacagcaaagagagagccttg
ctgcagcagctggaggagcggaggcaggagaaatcagccggagaggaaaatttgaagccc
tttactctgaactcctccatgtcggggaatcagaagcccagacctgcagcacgcagcgcc
gggtttgacaagaagcccatcagagcggcgaacaggccggcggctcgcacgaggacgtct
tcgaaaacgcaaggcgcggctcgcacggcgcagcaggcggagtccgagcccgacaacacg
gactccgccggcactacgaccgtctgtcagccggttcaggatgacagaacctgcgctgca
acaacacaggaagagacagacgaaacaatcacagaaggtcaaagcaacagctgcagcggc
gttcagccctgcggcgccgcagaggctcagaacccaggcgcaggtggatcagagacggct
gtggacaatccagtgaaatctctgaagcaatatgttacagtgaacctcacacggctctca
gtgcggcagagtttagaggccgaaaagctccgtggagctggaagcgttgcagcgagagga
aggagcaaacctaaaccagcaataaaacaaggttccaggtccgacacctgccccgctgag
gggaaaacagcagcggggcaggtcaatttaaggaagcggcaaagaggtgaggctgtggag
gagtcgtcacaagctgaggagaagagggctgacacggttgtcgaggtccaggtgctgtca
ggcgagcaggaagacaaacaaaaggagcagcaggatgtgttacaggtcagtgaagggcag
aaggaaaactctgcatctaatgctgtagaatgtgaaaatacaagagtggagaaagaagtt
aaagtgtccagagaaggaaggagaggacagaaaaagcaggctgtgtgtaagaggagagga
gcaccgaaagagtcgggacaaatgaggaggagtctgagtgacgagccagccagtagaaag
gaagacgttgttataaaacaggcgaaggttctgctgtcggatgtcttaagaaaagataaa
tccctaataaaaaaaaaacctcaggggaatgtaggaacagagttgtgcagcgcgccgtct
aaacaaccagaacaaactgaaatgaatggaaatcgatgtcggggaaggatgatgagaaga
cgaaagatgctgcgcagaacgtggaaaaccaaagccgagaagaagcaaggcgccgacgga
cactcgagcgacggaatcccagcttcagccaagatggacgccagcaagaaaagttgtcct
tttcagccggaacagagacgcaacgaaacgccaaccacctgcctcaacacgctacctcac
agggcgcaggtttcagctaaagctaacccacagctgcacacgcagtccaacatacctctg
aagaaacggacgtttcgcagctccgtggacatggactctgagcagagcgtgaactctgtt
tcaggtcagcttctgaaaaaaactcctgagctgagctcacatgcagcaccaaaacacaac
tctgccccatgtttaggagagaatcatctaaaaagagacaataaaggcaaaaccgtctcc
aaaaggacgacaaaacagccgtcctcctccagaacgcttcgccccagaggtaacgaagct
cagcgaggccatctgctgaggaaagttaagaaatgttcgtctcagaggcaggatgaggac
atccgggatcagacagcacagagtgatgagcttgcggaggacaaagacgctgagggcaaa
cttaaaagtctgtctctacctgaattgtcagcaaaagatcagctgcaaacaaactgcctg
gagccgagcgactcggaggagaccaagccggcgtttgatttaaagtttcgcctcaagagg
agacgagggaaggtttgggagatgcaaactgaaggcgtggtgttaaaatccgaaaagaaa
gaggatttaatggcgtgcgatccctttaaagccatcatggactctgtgtcgatcctaaac
atggagatggaggctcacgttcaggcgagtaagaagtcaaagagcagatcggatcggttc
aaacaaagacacgaaaggttcggcaaaaactctgaaagtctatgcgggccaagtgaattc
accggcgggaaagtcgaggttaaagagaagttcgacagaatccagcaggtgtcggagaaa
tcagagagtcagaacagcgagggcgtctcagcggttcaggaacccaaaactgaagatcgt
tttttaaacaactgctgcctgtttgaaagcggcctgcaacaaaagctggagcccgagctg
ggggcaaacggcctttcgttaccaatcataaaactacggagaaagacggaggacatttgg
gaggtggacagcaaaaaggggctcttacagccagatctcatcacagagcccaaaattaaa
agggagacaaaaatctcgtgtagaacaaaaggattcagtgatttaggcacgctcaaagac
gagaacccatcctatcagagacttcacagcaatcaagccccttctaagacagatctacct
ccattttcattgtctctatcaccgctgtcgctgtcttcgcccctgaatgagaataaagct
gaaggtgcagacagattgactgaaaggtcaaagatgatggaggaggagaggaaacagagg
cacagagtggacagatcgcgccggtgtgggcccgtggaaacacccaccacttgccttagt
cacacacttcaacaaattgacaacagcctctccaggctgtccgaaggcttgtgttcgtct
cagacgctggaaaagcccccagcctgttccggcacttcaaattcagtcatccagaccccg
tccgagtctccgctgttcgccgccgcagacaacatgctctctggggagcccagctttacg
aactgctgcgacgacatcctggacttccagtgtctcagcttcgagccgcagaatattctc
ccatcttcaccgtcagatctgtgctcgctggatccaccgacggaccctttcagcagcccc
ctctctcacagcccgtctgacacctggaccaccgaaacgccgtatcttggccccccaagt
ccgcagaataacttcaccagcgaggatttgcagttttttccaggtttaatttcttccaaa
aatgactctgttccttttgagtgtggggctaaggatgcctctaaagacaagcacccaccc
aaccctgcttgtgggttttcagctttggggaactctgacttgatggccaaggatcgaagc
agaaattcaggaatgaggttctccaaagagtctgcagctgttgccagcaagcctcgattt
tatggcggatcttcatcctccgttgcaactcaaagtccagtttcttttacgcaaacgtcc
gccaacatcaagcctagctcctgccagtcaaaatcccacctgagcctgaaaacccagggc
ccatttcaccgtatgaccattccaactaaatccccgaccttcccgagtaacccgggcaga
ggagtgtcctctcagacgtccaacaggttcccgtctcctcagctgttctcggttaaaaat
ccaaatcctcctgaaagttcattcaacttccaagaaaagccctctacagttatccacagg
gtcctcaagtttcaggggggtaatcagacccagaacttgtacagtgcaccttgtaaagac
gccgcggctgttggaggcctgaccgtcccaccgaggagatccggagatcctgaaaagact
ccgaagtttggtgtttacacggaacgttctcacaaaagcaacacttcagtccatctcagc
cagcttggcccccccaccaaccccagcagacccaacctacattttaccaaacctaattct
tccacttcacagtcgtttgggaaaaacaagatgatgtccgacaagcaggagggcggcgaa
cccaacgcggcgtacaaaaacttctcggagctgcccaggcccttcttctttcccagcaaa
gggtccgactgttacctatcgccacaagacaagagtctgaaactggacaaggccgctgcg
tcctcctctgacaaacaccagctctgttacacgcagcaggacgcgtacgacttcagctac
agctcccctctgtcgcccatgtctcagcacagcagcaccccccctgctacaccagcacac
gccaacaagagtcagcccccctcctcagcctccttcccctacggctaccaaggccctccc
tacgtgctgaacttcagcggggaccactcgctgaccctgggtctcagggacggcacggag
ggctacccgggcttaggctcgacgaactacacctaccactgcctgatggagccgtcgggc
acgcaggggcgcctggttctggagccctgcggcccccagctggccaacccgtcgtccttg
ggtgggttcgccgggctcaaaggtcaggacgagcactgcaggaaggacatgcagcagcag
tgcccgcccggagaacaccagggggcaccgcactacggacccgttacgtctcactccatg
ggtgcaacgaaacccaagagggtgaggttagtggtgacagacgggacggtggacctggac
ctccagtactcggactga

DBGET integrated database retrieval system