KEGG   Kryptolebias marmoratus (mangrove rivulus): 108237918
Entry
108237918         CDS       T05608                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04068  FoxO signaling pathway
kmr04110  Cell cycle
kmr04115  p53 signaling pathway
kmr04218  Cellular senescence
kmr04310  Wnt signaling pathway
kmr04340  Hedgehog signaling pathway
kmr04371  Apelin signaling pathway
kmr04510  Focal adhesion
kmr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108237918 (ccnd1)
   04340 Hedgehog signaling pathway
    108237918 (ccnd1)
   04371 Apelin signaling pathway
    108237918 (ccnd1)
   04068 FoxO signaling pathway
    108237918 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108237918 (ccnd1)
   04115 p53 signaling pathway
    108237918 (ccnd1)
   04218 Cellular senescence
    108237918 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108237918 (ccnd1)
   04530 Tight junction
    108237918 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C PX
Other DBs
NCBI-GeneID: 108237918
NCBI-ProteinID: XP_017275142
UniProt: A0A3Q3FY67
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKARLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIHPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDPSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSGTTETKHADEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactctatcaggagagcctaccaggacgtc
aacctgctcaacgaccgagttctgcagaccatgctgaaggcagaggagaactacctaccc
tcgccgaactactttaaatgtgtccagaaagaaattgtgcccaaaatgaggaaaatacta
gctacgtggatgttagaggtctgcgaggaacagaagtgcgaggaggaggtttttccgctg
gctatgaactatttggacagatttttatcggtggaggccactaggaaagccagactacag
ctgctcggagctacgtgcatgttcttagcatccaagatgaaggagaccgtgcccttaacg
gcggagaagctctgcatctacacggacaactcggtccttcccggagaactgctgcaaatg
gagcttctggttctcaacaagctgaagtgggatctggcttcggtcacgcctcacgacttt
attgagcacttcctgtccaagctgaagatccacccatccacaaagcagatcctcaggaag
cacgctcagaccttcgtggcgctctgtgctacagatgtcaacttcatcgccagtcctcca
tccatggtggcagcgggcagtgtggtggctgctgttcaaggtctttacctgaagagccaa
gatccctccttgtcctcccagaatctgaccaacttcttgtcacaggtcattcgcagtgac
ccggactgcttacggtcgtgtcaggagcagatcgagtccctgctggagtccagcctgcgg
caggctcagcagcacagcggtacaacagaaaccaaacacgccgacgaggaggtagacctg
tcctgcacgcccacggacgtgcgagacgtcaacatttga

DBGET integrated database retrieval system