KEGG   Kryptolebias marmoratus (mangrove rivulus): 108238930
Entry
108238930         CDS       T05608                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108238930 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108238930 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:kmr04052]
    108238930 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:kmr00536]
    108238930 (fgf1)
Cytokines and growth factors [BR:kmr04052]
 Growth factors
  Growth factors (RTK binding)
   108238930 (fgf1)
Glycosaminoglycan binding proteins [BR:kmr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108238930 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 108238930
NCBI-ProteinID: XP_017276787
LinkDB
Position
Unknown
AA seq 193 aa
MKAAWFSSSCLLSCLRHREQSEPPLFSHPQGRRSLFSTPQTQRGMSEGDVTVLPFGPSPL
DLSKKEQRTQVRLYSQNGGYHLRISPDGAVNGGRQENDPYEILKLTAVNVGVVVIKGETA
GRYLAMNKNGCLYGSQALNDECHFLEKYKENNYNTYRSQKYSWYVALKRNGQPKMGPHTH
QGQKAIFFLPRPA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaaggcggcgtggttctcctcttcttgtctcctctcgtgtctcaggcacagagaacaa
agtgaacctcctctgttttcacatcctcagggacgccgctcgcttttctccacacctcag
actcaacgtgggatgtctgagggggatgtgacggtgctgccgtttggcccctcacccctg
gacctgtccaagaaggagcagcgcacccaggtcaggctctacagccagaatggaggatat
cacctgaggatttcaccagatggagcagtgaatggtgggaggcaggaaaacgatccctat
gaaatcctgaagctgactgccgtgaacgtgggagtggtggtcatcaaaggcgagacggcc
ggaaggtacctggctatgaacaaaaacggatgcctttacggatcacaagcgctgaacgat
gagtgtcacttcctggagaagtacaaggagaacaactacaacacataccgctctcagaaa
tacagttggtatgtcgctttaaaaaggaatggccagcccaaaatgggaccacacacccac
cagggtcaaaaggccatctttttcctgccaaggcctgcttga

DBGET integrated database retrieval system