KEGG   Kryptolebias marmoratus (mangrove rivulus): 108239073Help
Entry
108239073         CDS       T05608                                 

Gene name
dnmt3a
Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00270  Cysteine and methionine metabolism
kmr01100  Metabolic pathways
Module
kmr_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    108239073 (dnmt3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:kmr03032]
    108239073 (dnmt3a)
   03036 Chromosome and associated proteins [BR:kmr03036]
    108239073 (dnmt3a)
Enzymes [BR:kmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     108239073 (dnmt3a)
DNA replication proteins [BR:kmr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    108239073 (dnmt3a)
Chromosome and associated proteins [BR:kmr03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108239073 (dnmt3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP Ndc1_Nup Presenilin SOG2
Motif
Other DBs
NCBI-GeneID: 108239073
NCBI-ProteinID: XP_017277034
UniProt: A0A3Q3B3V5
LinkDB All DBs
Position
Unknown
AA seq 985 aa AA seqDB search
MMPSNTVTNTTAFKGADFADSPGNRMGESTILDMDLMEEEKSTLNSASCKVGKPGRKRKP
FPVESCGSLTDSRSVGNSYSGVCRPFMTQVHNGDMMLDGCFPKQEKREVENGIPRDPLSS
CQAEDSSQGPSLSPSMENGFLSGREEQDLEKERDDGVMMPRKKRGRRKLERPTKYVEHKE
DEGCDAIKTEGGRGRQRGGVGWEISLRQRPMPRITFQAGDPYYISKRTREEWMAKWKMEA
EKKAKLMSAMNTMKDNKNETESEKEEVSIIKHPQPSKQQQQPQPQPQPQSQHSQSLSQPQ
YQQQSQSSLPQQQQHMQPPQQQQQPTDPASPTVATTPEPVTIGGEDKTSPKSADAEPEYE
DGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLL
PLSSFNNAFHQPTYNKQPMYKKAIYEVLQVASSRAGKTFMACPDSDETETSKSVEMLNKQ
MIEWAKTGFQPTGPRGLEPPEEERSNSEVYPEMWVEPEAAAYTPPPAKKPRKSTVEKPKV
KEIVDERTRERLVYEVRQKSRSIEDICISCGGLNVSLEHPLFGGGMCQSCKNCFLECAYQ
YDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAALAAIKEDPWNCYMCC
PKGVFGLLERRSDWPNRLQHFFANNHDQDFDPPKLYPPVMVEKRKPIRVLSLFDGIATGL
LVLKELGIQVDRYVASEVCEDSITVGIVRHHGRIMYVGDVRNVTRKHIQEWGPFDLVIGG
SPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHEARPKEGDDRPFFWLFENVVAMGVSDKR
DISRFLECNPVMIDAKEVSAAHRARYFWGNLPGMNRPLTAMCTDRLDLQDCLEHGRTAKF
GKVRTITTRSNSIKQGKDQHFPVYMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQR
LLGRSWSVPVIRHLFAPLKDYYACV
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtccaacactgtcaccaacaccactgcattcaaaggcgccgactttgctgat
tcacctggaaacagaatgggtgagagcacaatactggacatggacctgatggaggaggag
aagtcgactttaaacagtgcctcttgtaaagttggaaagcctgggagaaagcgcaagcca
tttccagtggagagctgcggctccctcacagacagtcggagtgttggcaacagttactcc
ggggtgtgtagacccttcatgacccaagtccacaatggagacatgatgctcgatggctgc
ttccccaaacaggagaagagggaagtggagaacgggatccccagagaccccctgtcctcc
tgccaggcagaggacagctcccagggcccgagcctgagtccgtccatggagaacggcttc
ctgtccggcagggaggagcaggacttggagaaggagcgggatgacggggtgatgatgccg
cgcaagaaaagagggagacggaaactagagcgtccgacgaaatatgtggagcacaaggag
gatgaggggtgtgacgcaatcaagactgagggaggtcgaggcaggcaacgagggggagtt
ggttgggagatcagccttcgtcagaggcccatgcccagaataaccttccaggctggtgac
ccatattacattagcaaacggaccagggaggagtggatggccaagtggaagatggaggca
gagaaaaaggccaagctcatgtcagcgatgaacacaatgaaggacaacaagaatgaaacc
gagtctgagaaggaggaggtctcgataatcaaacacccacagccttcaaaacaacaacag
cagcctcagcctcagccgcagcctcagtctcagcacagccaatctctgtcacagcctcag
tatcagcaacaatcccagtcgtctctgcctcagcagcaacaacacatgcagcctcctcag
cagcagcagcagcctactgacccagcctcccccacagtggcaaccaccccagagcccgtc
accatcggaggagaggacaaaacttcccccaagtctgcagacgctgagcccgagtacgag
gacggtcgtggttttggcatcggggagctggtttgggggaagctgcgaggattttcctgg
tggccgggccgcatcgtatcctggtggatgacgggccggagcagagctgccgagggaacc
agatgggtcatgtggtttggagatggaaagttctctgtggtctgtgtggagaagcttctg
cctttaagttcctttaataatgcctttcaccaaccaacctacaacaaacagcccatgtac
aaaaaagcaatctatgaagtgttacaggtggctagcagccgagctggaaaaaccttcatg
gcgtgccctgacagcgatgagacagaaacctccaaatcagtggaaatgttaaacaagcag
atgattgagtgggcgaagaccgggtttcagcccaccggaccccggggcttagagccacca
gaggaggagcgtagtaactcagaggtctaccccgagatgtgggtggaaccggaagcggcg
gcctacacgcctcctccagccaaaaagcctcgcaagagcaccgtggagaaacccaaagtc
aaggagattgttgacgaaagaacacgagagcggttggtttatgaagtgagacaaaaatct
cgcagtatagaggacatctgtatctcctgtggaggcctgaacgttagcctggagcaccct
ctgtttggtggaggaatgtgtcagagctgcaagaattgcttcctcgaatgtgcgtatcag
tacgatgatgatggttatcagtcgtactgtactatctgctgcggtggccgcgaggtgctc
atgtgtggaaacaacaactgctgtcggtgcttctgtgtagaatgcgtggacctcctcgtc
ggtccgggagccgccctcgccgccatcaaagaggacccgtggaactgctacatgtgctgt
ccgaagggtgtgttcggtctgctggagcgccgctcagactggcccaaccgcctgcagcac
ttctttgcaaacaaccacgaccaagattttgatccaccaaagctttacccccctgtcatg
gtggagaagaggaagcccatccgggtcctgtcgctcttcgatggcatcgcaacagggctc
ctggtgttgaaagaacttggcatccaagtggatcgctacgtagcctctgaagtatgcgaa
gactccatcaccgtaggaatcgtccggcaccacggacggatcatgtacgttggtgatgtg
aggaacgtcacacgcaaacatattcaggagtggggtccttttgaccttgttattggtggg
agcccctgcaacgacctgtcgatagtcaatcctgctaggaagggtctgtatgaaggcacc
ggtcgcctcttctttgagttttaccggctgctccacgaggctcggccgaaggagggggac
gaccggccgttcttctggctctttgaaaacgtggtggccatgggtgtcagtgacaagagg
gacatatcccgctttttagagtgtaacccagtgatgatcgacgctaaggaggtgtctgcc
gcccaccgcgcccgttacttctggggtaaccttcctgggatgaacaggcctctgacagcg
atgtgcacggacaggctggacctccaggactgtttggaacacggcagaacagctaagttt
ggcaaagtgaggaccatcaccaccaggtctaattccatcaagcagggcaaggaccagcac
ttccccgtctacatgaatgaaaaggaagatatactctggtgcactgagatggagagggtg
tttggcttccccgtccactacacggacgtgtccaacatgagccgactggcgaggcagagg
ctcctgggccgatcctggagcgtccctgtcatccgccacctgtttgcaccactcaaagat
tactacgcctgcgtctga

DBGET integrated database retrieval system