KEGG   Kryptolebias marmoratus (mangrove rivulus): 108239405
Entry
108239405         CDS       T05608                                 

Definition
(RefSeq) transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04137  Mitophagy - animal
kmr04210  Apoptosis
kmr04218  Cellular senescence
kmr04620  Toll-like receptor signaling pathway
kmr04621  NOD-like receptor signaling pathway
kmr04622  RIG-I-like receptor signaling pathway
kmr04623  Cytosolic DNA-sensing pathway
kmr04625  C-type lectin receptor signaling pathway
kmr04920  Adipocytokine signaling pathway
kmr05132  Salmonella infection
kmr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108239405
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108239405
  09143 Cell growth and death
   04210 Apoptosis
    108239405
   04218 Cellular senescence
    108239405
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108239405
   04621 NOD-like receptor signaling pathway
    108239405
   04622 RIG-I-like receptor signaling pathway
    108239405
   04623 Cytosolic DNA-sensing pathway
    108239405
   04625 C-type lectin receptor signaling pathway
    108239405
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108239405
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108239405
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108239405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kmr03000]
    108239405
Transcription factors [BR:kmr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108239405
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 108239405
NCBI-ProteinID: XP_017277586
UniProt: A0A3Q2ZPF3
LinkDB
Position
Unknown
AA seq 629 aa
MDGVYGWGLTPLNPVQPASPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNPPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPYNIPEPKVWEEEFDLNSVRLCFQASITLPAGELFPLEPVV
SQPIFDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRNTNLSEPVKVKMQLRRPSDREVSEPMDFQYLPADPDEYRLS
DKRKRTGDMFQNLKLGPMLSSVSIPQDKRHINFGRRTVTSKPPSMAAQAVPEAPRAVSAA
SYQFPQPGQLFSVQPKMEPTSSIAAATTTQTWEIMESLKLGPQPKANPVATFPMSSAPTP
PSSTATTTSTANKDYSTVNMSQLHEFFPNIAQEVTTTTQVPASSSFSLQESQFHVDSTLM
DEDIPEFPSFSDAQVPGTLDSLNMEDLEDLLNPRLMSEGGNGTSALPSCQQASAPKSTTP
AQNGAASQSAPEPASNHGTTYMNYPNSIANLLRNEDMMGLNSSGAISNNNHHQSAVLDDF
DELMSADEERLMSIFNSGSQAGFVSGHPT
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggacggtgtgtacggatgggggctgaccccattaaacccagtccagccagcgagccct
tacattgagatcatcgagcagccgaagcagagggggatgaggtttcgctataagtgcgag
ggacgttcagctggcagcatccctggagagaaaagcaacgacacaacaaagacttaccca
gccattaaggtgcacaactacagcggtcccctacgggttcgcatctcattggtgacgaag
aaccccccgtacaagcctcacccccacgagctggtggggaaagactgcaagcacggctac
tacgaggctgacctgcaggagagacggatacacagttttcagaacctgggcatacagtgt
gtgaagaagaaggatgtgaatgaggccatcacttgtagactgcagaccaataacaacccc
tacaatattcctgagcccaaggtgtgggaggaagagttcgacctgaactcggtgcggctc
tgcttccaggcctccatcaccctgcctgcgggggagctgttccccctggagcccgtcgtc
tcacagcccatcttcgacaacagagccccaaacacggccgagctgaagatctgccgggtc
aaccgcaactctggcagctgcaaaggaggggacgagatcttcctgctgtgcgacaaagtg
caaaaagaagacatcgaagtgcgtttcttccaggactcctgggaggggaagggcacgttc
tcccaggccgacgtccacaggcaggtggcgatcgtcttccgtacgccgccgtaccgcaac
actaacctgagcgagcctgtcaaggtgaagatgcagctgcggcggccctccgatcgagag
gtcagcgagcccatggacttccagtacctgccagccgacccagatgagtacaggctgagt
gacaagagaaagcgcacaggagacatgttccagaacctgaagctgggcccgatgctttcc
agtgtgtccatcccacaagacaaacggcacataaactttggacggagaacggtcacgtcc
aagcctccgtccatggctgcacaagcagtccctgaggctccccgtgctgtcagcgcggct
tcctaccagttccctcagccgggacagctcttctcagtccagcccaagatggagcccacc
tcctccatcgccgcggcgacgacaacccaaacctgggagatcatggagagtctgaagctg
ggccctcagcccaaagccaacccagtggccacctttccgatgagctcggcgcccacccct
ccctcctcgaccgccaccaccacctccacagccaacaaggactactccactgtcaacatg
tcccagcttcatgaattcttccccaacatcgcccaggaggtgaccacgactactcaggta
cccgccagcagctccttctctctccaggagtctcagttccacgtcgactcgacactcatg
gacgaggacatcccggagttccccagcttctctgacgcccaggtacccggcaccctggac
agcctaaacatggaagatttagaggacctcctgaacccccgcctcatgagcgagggcgga
aatggcacctcggcgttgccgtcatgccagcaggcgtctgcccccaagtccaccactccc
gctcagaacggcgccgcgtcccaaagcgcgcccgagccggccagcaaccacggcaccacc
tacatgaattacccgaacagcatcgctaacctgctccggaacgaagacatgatgggcctg
aactccagcggcgccatcagcaacaacaaccaccaccagtccgcggtgctcgatgacttt
gatgagctgatgtccgccgatgaggagcgcctcatgtccatttttaatagcggaagtcaa
gctgggtttgtatcaggacacccaacctaa

DBGET integrated database retrieval system